Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10200 243 / 3e-82 LIM WLIM1, SF3 WLIM1, GATA type zinc finger transcription factor family protein (.1) AT3G55770 204 / 6e-66 LIM WLIM2b WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) AT2G39900 201 / 1e-65 LIM WLIM2a WLIM2a, GATA type zinc finger transcription factor family protein (.1) AT1G01780 183 / 3e-58 LIM PLIM2b PLIM2b, GATA type zinc finger transcription factor family protein (.1) AT3G61230 181 / 2e-57 LIM PLIM2c PLIM2c, GATA type zinc finger transcription factor family protein (.1) AT2G45800 176 / 4e-55 LIM PLIM2a PLIM2a, GATA type zinc finger transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043462 [exp] 345 / 4e-122 AT1G10200 260 / 2e-89 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10004230 [exp] 299 / 5e-104 AT1G10200 281 / 1e-97 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10042140 [exp] 299 / 5e-104 AT1G10200 280 / 2e-97 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10039010 [exp] 241 / 3e-81 AT1G10200 285 / 2e-99 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10018674 [exp] 237 / 1e-79 AT1G10200 323 / 4e-114 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10027305 [exp] 235 / 9e-79 AT1G10200 280 / 2e-97 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10010455 [exp] 227 / 1e-75 AT1G10200 277 / 3e-96 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10007748 [exp] 228 / 2e-75 AT1G10200 308 / 5e-108 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10003822 [exp] 204 / 8e-64 AT3G03220 409 / 4e-143 EXPANSIN 13, expansin A13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G077200 [exp] 295 / 2e-102 AT1G10200 268 / 2e-92 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.015G072400 [exp] 287 / 3e-99 AT1G10200 277 / 5e-96 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.001G292900 [exp] 253 / 8e-86 AT1G10200 317 / 9e-112 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.009G087200 [exp] 248 / 6e-84 AT1G10200 316 / 2e-111 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.002G118000 [exp] 244 / 4e-82 AT1G10200 325 / 7e-115 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.014G015600 [exp] 241 / 4e-81 AT1G10200 327 / 8e-116 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.010G193800 [exp] 202 / 4e-66 AT3G55770 323 / 2e-114 WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) Potri.008G063600 [exp] 200 / 4e-65 AT3G55770 324 / 1e-114 WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) Potri.003G124300 [exp] 191 / 3e-61 AT3G61230 264 / 2e-90 PLIM2c, GATA type zinc finger transcription factor family protein (.1) Potri.001G107100 [exp] 187 / 7e-60 AT3G61230 256 / 6e-87 PLIM2c, GATA type zinc finger transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00412 [flax] [poplar] LIM LIM domain
Representative CDS sequence Show only first row Show all	>Lus10034123 pacid=23154666 polypeptide=Lus10034123 locus=Lus10034123.g ID=Lus10034123.BGIv1.0 annot-version=v1.0 ATGTTTGGAGGGACGACGCAAAAGTGTAAGGCGTGCGATAAGACAGTCTACTTTGTGGATCAGCTCTCTGCCGACAGCAAAGTCTATCACAAGTTCTGCT TCCGATGTCATCATTGCAAGGGCACCCTCAAGCTGAGTAATTATAGCTCCTTTGAGGGTGTCTTGTATTGCAAGCCTCATTTCAATCAGCTACTCAAAAT GACTGGCAGCTTGGATAAAAGCTTTCAAGGTACCCCGAAAACTGCGAGGATAGACCGATCTGCTGATCAGGTCAATGGCAGCAACAAAATCTCAAAGATG TTCTCCGGAACTCAAGACAAGTGTGTCACTTGCAAAAAAACTGTTTATCCAATCGAAAAGCATTCCATTACAGCTTTCACATCCCCACTCCGTTCGTCTC ATCGTTTCATAAAGTGTGAATGGTTGAAACAGCGAAAGCTTGAAGAGCTACTGATCGACATTGTGTTTGCTGGTGGGTTTGATCAGGTGGCAGTAGATGG AACATGTTACCACAAGGCATGCTTCAGGTGCAGCCATGGTGGATGCATGATAAGCCCTTCAAACTACGTAGCCCACGACCAACGTCTATACTGCAGACAC CACCATACCCAACTCTTCAAGGAAAAGGGAAACTTCAGCCAACTTACCAGCAACAAACTTCAAAATGGCAAACCTGTAATGGATCCAGCAGCAGAATGA
AA sequence Show only first row Show all	>Lus10034123 pacid=23154666 polypeptide=Lus10034123 locus=Lus10034123.g ID=Lus10034123.BGIv1.0 annot-version=v1.0 MFGGTTQKCKACDKTVYFVDQLSADSKVYHKFCFRCHHCKGTLKLSNYSSFEGVLYCKPHFNQLLKMTGSLDKSFQGTPKTARIDRSADQVNGSNKISKM FSGTQDKCVTCKKTVYPIEKHSITAFTSPLRSSHRFIKCEWLKQRKLEELLIDIVFAGGFDQVAVDGTCYHKACFRCSHGGCMISPSNYVAHDQRLYCRH HHTQLFKEKGNFSQLTSNKLQNGKPVMDPAAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55770	LIM	WLIM2b	WLIM2b, GATA type zinc finger ...		Lus10034123 [exp]	0	1
AT2G17080			Arabidopsis protein of unknown...		Lus10025121 [exp]	2.0	0.9059
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10040468 [exp]	2.4	0.9247
					Lus10025501 [exp]	2.6	0.9285
AT4G37030			unknown protein		Lus10011021 [exp]	3.5	0.9153
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10026430 [exp]	8.5	0.8867
AT2G30270			Protein of unknown function (D...		Lus10026421 [exp]	8.5	0.8377
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10024991 [exp]	9.1	0.8327
AT3G11550		CASP2	Casparian strip membrane domai...		Lus10004205 [exp]	9.9	0.9006
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012183 [exp]	11.0	0.8987
AT4G36380		ROT3	ROTUNDIFOLIA 3, Cytochrome P45...		Lus10041794 [exp]	11.5	0.8930

Compare expression of checked genes

Lus10034123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.