Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62710 60 / 2e-12 Glycosyl hydrolase family protein (.1) AT5G04885 59 / 5e-12 Glycosyl hydrolase family protein (.1) AT3G47000 41 / 7e-06 Glycosyl hydrolase family protein (.1) AT3G47040 41 / 9e-06 Glycosyl hydrolase family protein (.1.2) AT3G47050 40 / 2e-05 Glycosyl hydrolase family protein (.1.2) AT3G47010 39 / 4e-05 Glycosyl hydrolase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034848 [exp] 58 / 1e-11 AT5G20950 823 / 0.0 Glycosyl hydrolase family protein (.1.2) Lus10010657 [exp] 58 / 1e-11 AT5G20950 889 / 0.0 Glycosyl hydrolase family protein (.1.2) Lus10013646 [exp] 57 / 1e-11 AT5G20950 941 / 0.0 Glycosyl hydrolase family protein (.1.2) Lus10005706 [exp] 57 / 2e-11 AT5G04885 863 / 0.0 Glycosyl hydrolase family protein (.1) Lus10023604 [exp] 57 / 3e-11 AT5G20950 822 / 0.0 Glycosyl hydrolase family protein (.1.2) Lus10008434 [exp] 56 / 5e-11 AT5G04885 796 / 0.0 Glycosyl hydrolase family protein (.1) Lus10013388 [exp] 56 / 6e-11 AT5G04885 801 / 0.0 Glycosyl hydrolase family protein (.1) Lus10008432 [exp] 55 / 1e-10 AT5G20950 927 / 0.0 Glycosyl hydrolase family protein (.1.2) Lus10013390 [exp] 54 / 3e-10 AT5G20950 935 / 0.0 Glycosyl hydrolase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G013500 [exp] 59 / 6e-12 AT5G04885 966 / 0.0 Glycosyl hydrolase family protein (.1) Potri.008G013700 [exp] 57 / 1e-11 AT5G20950 901 / 0.0 Glycosyl hydrolase family protein (.1.2) Potri.009G153900 [exp] 57 / 3e-11 AT5G20950 937 / 0.0 Glycosyl hydrolase family protein (.1.2) Potri.019G037400 [exp] 55 / 1e-10 AT5G20950 926 / 0.0 Glycosyl hydrolase family protein (.1.2) Potri.005G059200 [exp] 53 / 5e-10 AT5G04885 385 / 8e-131 Glycosyl hydrolase family protein (.1) Potri.009G154802 [exp] 52 / 6e-10 AT5G04885 232 / 5e-72 Glycosyl hydrolase family protein (.1) Potri.013G055600 [exp] 52 / 1e-09 AT5G20950 932 / 0.0 Glycosyl hydrolase family protein (.1.2) Potri.009G154032 [exp] 50 / 3e-09 AT5G20940 254 / 7e-82 Glycosyl hydrolase family protein (.1) Potri.009G042800 [exp] 44 / 1e-06 AT3G47000 934 / 0.0 Glycosyl hydrolase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01915 [flax] [poplar] Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10034128 pacid=23154889 polypeptide=Lus10034128 locus=Lus10034128.g ID=Lus10034128.BGIv1.0 annot-version=v1.0 ATGAGGAAGACGTGCAGCAGTGGCGTCAAATGTGTAGTGATCCTGATATCAGGGAGGCCATTGGTGATAGAGCCGTTCCTTCCGTCAATGAATGCTCTCG TGGCTGCATTCTTGCCCGGTTCGGAAGTTGTTGGGGGATTATGGCTTCACAGGGAAGTTGGCCAGGACTTGGATGAAGAGAGTTGA
AA sequence Show only first row Show all	>Lus10034128 pacid=23154889 polypeptide=Lus10034128 locus=Lus10034128.g ID=Lus10034128.BGIv1.0 annot-version=v1.0 MRKTCSSGVKCVVILISGRPLVIEPFLPSMNALVAAFLPGSEVVGGLWLHREVGQDLDEES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62710			Glycosyl hydrolase family prot...		Lus10034128 [exp]	0	1
AT4G16990		RLM3	RESISTANCE TO LEPTOSPHAERIA MA...		Lus10000574 [exp]	1.0	0.8273
AT2G27520			F-box and associated interacti...		Lus10004586 [exp]	2.4	0.7541
AT1G77760		GNR1, NIA1	nitrate reductase 1 (.1)		Lus10031005 [exp]	6.9	0.7523
AT5G52390			PAR1 protein (.1)		Lus10040714 [exp]	12.6	0.6893
					Lus10018591 [exp]	14.5	0.6735
AT1G17930			Aminotransferase-like, plant m...		Lus10033415 [exp]	19.9	0.6646
					Lus10035698 [exp]	21.2	0.6380
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10006704 [exp]	22.5	0.6241
					Lus10019813 [exp]	24.1	0.7194
AT3G03480		CHAT	acetyl CoA:(Z)-3-hexen-1-ol ac...		Lus10020334 [exp]	25.3	0.6079

Compare expression of checked genes

Lus10034128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.