Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46960 113 / 2e-31 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT2G46950 113 / 1e-30 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT4G27710 108 / 7e-29 CYP709B3 "cytochrome P450, family 709, subfamily B, polypeptide 3", cytochrome P450, family 709, subfamily B, polypeptide 3 (.1) AT2G26710 92 / 6e-23 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14610 86 / 5e-21 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14620 84 / 4e-20 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14640 83 / 8e-20 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14660 81 / 3e-19 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14690 81 / 5e-19 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT5G24900 79 / 2e-18 ELA2, CYP714A2 EUI-like p450 A2, cytochrome P450, family 714, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025756 [exp] 155 / 4e-46 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10025755 [exp] 153 / 1e-44 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1) Lus10035907 [exp] 139 / 4e-40 AT2G46950 498 / 7e-172 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10033044 [exp] 83 / 8e-20 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017771 [exp] 82 / 1e-19 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036823 [exp] 78 / 7e-19 AT3G14610 227 / 2e-71 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) Lus10010802 [exp] 79 / 9e-19 AT1G75130 432 / 6e-150 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010821 [exp] 79 / 2e-18 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10036820 [exp] 78 / 4e-18 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G022200 [exp] 108 / 4e-29 AT2G46950 527 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Potri.004G100400 [exp] 99 / 2e-25 AT5G38450 734 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.014G180500 [exp] 96 / 2e-24 AT1G75130 494 / 6e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.005G035200 [exp] 96 / 2e-24 AT1G75130 547 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.006G154500 [exp] 91 / 1e-22 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.017G114200 [exp] 91 / 1e-22 AT5G38450 724 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.018G070900 [exp] 91 / 1e-22 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.002G134500 [exp] 83 / 7e-20 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.015G145100 [exp] 80 / 8e-19 AT5G52400 646 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Potri.002G263800 [exp] 79 / 3e-18 AT1G75130 493 / 2e-171 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10034134 pacid=23154697 polypeptide=Lus10034134 locus=Lus10034134.g ID=Lus10034134.BGIv1.0 annot-version=v1.0 ATGGACGAATGTAGATCATTCTTCTTCTCTGGCCACCAAACCACCTCCAATCTATTGACATGGGCCATTTTCCTTCTTACCATACACCAAAAATGGCAGC AGAGTCTCAGGGAAGAAGTCCTCAAAGAGTGTAGGATGAACAATACTCTTGATGCTGATTCATTACCAAAGCTCGAATTGAATATGAATTTGGTGCTATT GGAGACTTTGAGGACGGCAACTAAAGACATGAAATTGGGGGACTTGGATATCCCTAAAGGAACCTCTTTATATATTCCTATCATCATGATCAACAAGAGC AAATAA
AA sequence Show only first row Show all	>Lus10034134 pacid=23154697 polypeptide=Lus10034134 locus=Lus10034134.g ID=Lus10034134.BGIv1.0 annot-version=v1.0 MDECRSFFFSGHQTTSNLLTWAIFLLTIHQKWQQSLREEVLKECRMNNTLDADSLPKLELNMNLVLLETLRTATKDMKLGDLDIPKGTSLYIPIIMINKS K

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46960		CYP709B1	"cytochrome P450, family 709, ...		Lus10034134 [exp]	0	1
AT2G44420			protein N-terminal asparagine ...		Lus10033495 [exp]	5.7	0.9364
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10000038 [exp]	12.5	0.9348
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036820 [exp]	14.6	0.9343
AT2G01170		BAT1	bidirectional amino acid trans...		Lus10035260 [exp]	17.3	0.9303
AT1G72890			Disease resistance protein (TI...		Lus10006929 [exp]	20.6	0.9297
					Lus10014873 [exp]	21.5	0.9299
AT2G44180		MAP2A	methionine aminopeptidase 2A (...		Lus10027121 [exp]	21.5	0.9301
AT1G67940		ABCI17, AtSTAR1...	ARABIDOPSIS THALIANA NON-INTRI...		Lus10031069 [exp]	22.5	0.9289
AT2G37050			Leucine-rich repeat protein ki...		Lus10019237 [exp]	25.5	0.9311
AT4G13400			2-oxoglutarate (2OG) and Fe(II...		Lus10017737 [exp]	28.1	0.9204

Compare expression of checked genes

Lus10034134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.