Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034143 pacid=23154677 polypeptide=Lus10034143 locus=Lus10034143.g ID=Lus10034143.BGIv1.0 annot-version=v1.0 ATGTTGGCCTTCATAACAGCTGACCAGCCCTTTGCGGTTGCGGTGGTGGAAGGTTCTGATCCAGACGCCGGTCATGATCAAGTGGAAGAGGTGGAAAATG GAGCTGGGGCGGCAGACAAGGTGGAAGGCAGTGGAGGAGAGACCGAGGGGGTTGATGCTAATTATGACGGAGAGGGAGAGGAAGGGGACCCAGATGAGGT GGAAAACAGTAGCGCCGGCGGTGGGGATGAAGATGAGGGCGAAGTAGTGGAAGGTGGCGGAGATGAAGGAATGCTAAAGTTTCATAATAGAGGGGGCTAA
AA sequence Show only first row Show all	>Lus10034143 pacid=23154677 polypeptide=Lus10034143 locus=Lus10034143.g ID=Lus10034143.BGIv1.0 annot-version=v1.0 MLAFITADQPFAVAVVEGSDPDAGHDQVEEVENGAGAADKVEGSGGETEGVDANYDGEGEEGDPDEVENSSAGGGDEDEGEVVEGGGDEGMLKFHNRGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034143 [exp]	0	1
AT2G03630			unknown protein		Lus10029645 [exp]	1.0	1.0000
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Lus10012573 [exp]	2.0	0.9994
AT4G38590		BGAL14	beta-galactosidase 14 (.1.2)		Lus10005070 [exp]	3.5	0.9809
					Lus10014474 [exp]	4.2	0.9539
AT5G09550			GDP dissociation inhibitor fam...		Lus10035634 [exp]	5.0	0.9712
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10039010 [exp]	10.4	0.8775
AT2G20515			unknown protein		Lus10024890 [exp]	13.8	0.9162
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Lus10026697 [exp]	16.4	0.9761
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Lus10012572 [exp]	23.4	0.8243
AT1G12064			unknown protein		Lus10039031 [exp]	25.1	0.8598

Compare expression of checked genes

Lus10034143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.