Lus10034144 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27510 179 / 1e-58 ATFD3 ferredoxin 3 (.1)
AT1G60950 143 / 2e-44 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT5G10000 140 / 5e-43 ATFD4 ferredoxin 4 (.1)
AT1G10960 134 / 9e-41 ATFD1 ferredoxin 1 (.1)
AT4G14890 89 / 7e-23 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G32550 79 / 5e-19 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043430 303 / 2e-107 AT2G27510 179 / 3e-58 ferredoxin 3 (.1)
Lus10020616 169 / 1e-54 AT2G27510 172 / 9e-56 ferredoxin 3 (.1)
Lus10004870 168 / 4e-54 AT2G27510 165 / 5e-53 ferredoxin 3 (.1)
Lus10001369 134 / 1e-40 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10015462 131 / 1e-39 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10006116 83 / 1e-20 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10010557 83 / 5e-20 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10000483 76 / 2e-17 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10004576 74 / 1e-16 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G020100 214 / 2e-72 AT2G27510 180 / 5e-59 ferredoxin 3 (.1)
Potri.010G239100 214 / 3e-72 AT2G27510 175 / 7e-57 ferredoxin 3 (.1)
Potri.009G163800 187 / 2e-61 AT2G27510 167 / 7e-54 ferredoxin 3 (.1)
Potri.004G202500 183 / 1e-59 AT2G27510 164 / 3e-52 ferredoxin 3 (.1)
Potri.004G218400 143 / 2e-44 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G015200 141 / 2e-43 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.001G470700 133 / 3e-40 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.010G087300 82 / 1e-20 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.008G153200 82 / 2e-20 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G090400 76 / 2e-17 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10034144 pacid=23154829 polypeptide=Lus10034144 locus=Lus10034144.g ID=Lus10034144.BGIv1.0 annot-version=v1.0
ATGTCGACAGTAAAGCTTCCACTCTCCTGCATGATGCAAGCTGCACCTGTTTCCAAAGGTATGGTACAAAGCAGATCCCTGGCATTGGCAAACGCCCCAA
ATTCTTTTGGTTCCTCAAAGAAGAAGAACGTATCAGGGGGAATAGTTGGTTTGGAAAAGTCGAGATCATCGTTGTTGAGCGTATCTTGTGCAACGACAGT
ATACAAGGTGAAACTAGTTGGACCAGATGGGGAGGAGCACGAGTTTGAAGCTCCCGACGATACCTATATCCTGGATGCAGCTGAAAATGCAGGAGTGGAC
CTTCCCTACTCATGCAGGGCTGGTGCTTGCTCTACTTGTGCAGGACAGTTGGTGTCAGGGTCAGTGGACCAATCAGACGGCTCTTTCCTTGACGATAAGC
AGATTGAGAAAGGGTATGTCCTCACCTGCATCTCGTATCCCACAGCCGATTGTGTGATCCATACCCATAAGGAGTCCGATCTTTACTAA
AA sequence
>Lus10034144 pacid=23154829 polypeptide=Lus10034144 locus=Lus10034144.g ID=Lus10034144.BGIv1.0 annot-version=v1.0
MSTVKLPLSCMMQAAPVSKGMVQSRSLALANAPNSFGSSKKKNVSGGIVGLEKSRSSLLSVSCATTVYKVKLVGPDGEEHEFEAPDDTYILDAAENAGVD
LPYSCRAGACSTCAGQLVSGSVDQSDGSFLDDKQIEKGYVLTCISYPTADCVIHTHKESDLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10034144 0 1
AT4G40042 Microsomal signal peptidase 12... Lus10015793 1.0 0.9324
AT4G02340 alpha/beta-Hydrolases superfam... Lus10018477 3.0 0.9092
AT1G67370 ASY1, ATASY1 ASYNAPTIC 1, DNA-binding HORMA... Lus10037019 4.1 0.8998
AT1G07890 ATAPX01, CS1, A... maternal effect embryo arrest ... Lus10013537 4.2 0.9324
AT3G43520 Transmembrane proteins 14C (.1... Lus10027640 4.2 0.9247
AT2G01140 PDE345 PIGMENT DEFECTIVE 345, Aldolas... Lus10035247 5.3 0.9141
AT2G42910 Phosphoribosyltransferase fami... Lus10010935 5.7 0.9000
AT5G13420 Aldolase-type TIM barrel famil... Lus10032613 7.4 0.9173
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10016278 8.8 0.9047
AT1G65980 TPX1 thioredoxin-dependent peroxida... Lus10023662 8.9 0.9095

Lus10034144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.