Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04750 54 / 1e-10 F1F0-ATPase inhibitor protein, putative (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G240401 [exp] 66 / 1e-15 AT5G04750 57 / 3e-12 F1F0-ATPase inhibitor protein, putative (.1.2) Potri.008G016801 [exp] 60 / 5e-13 AT5G04750 56 / 8e-12 F1F0-ATPase inhibitor protein, putative (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034146 pacid=23154744 polypeptide=Lus10034146 locus=Lus10034146.g ID=Lus10034146.BGIv1.0 annot-version=v1.0 ATGGCCACCGGATCTGCGCTCGCTCGACTCGGCGGAACTCGCTCGCTCCTCCGCATTGGTTTGGTTCGCGCCATGGATTCAACTCGCGCCGCGACTCGCT ACTTTAGCGATGGCAAGGGCCGAGTCCTCAGCGAAGAGGAGCGTGCCAAAGAGACTGTCTATATACAGAAAATGGAGAGGGAGAGGCTGGAGAAGCAGAA GCTGAAAGCTGAGAAGGAGAAGGCAGAGAAGGAGAAAGAGAACGCTGAAAAGGGCTTGCAGAAAAATCTGGCAGTCTGTAACCTTCTGGATGTATCGACT TGCGCCGTTTAA
AA sequence Show only first row Show all	>Lus10034146 pacid=23154744 polypeptide=Lus10034146 locus=Lus10034146.g ID=Lus10034146.BGIv1.0 annot-version=v1.0 MATGSALARLGGTRSLLRIGLVRAMDSTRAATRYFSDGKGRVLSEEERAKETVYIQKMERERLEKQKLKAEKEKAEKEKENAEKGLQKNLAVCNLLDVST CAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04750			F1F0-ATPase inhibitor protein,...		Lus10034146 [exp]	0	1
AT1G54320			LEM3 (ligand-effect modulator ...		Lus10001834 [exp]	1.4	0.9020
AT5G61310			Cytochrome c oxidase subunit V...		Lus10010008 [exp]	2.6	0.8848
AT5G08560			transducin family protein / WD...		Lus10001411 [exp]	5.5	0.8971
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Lus10030666 [exp]	5.7	0.8948
AT5G02790		GSTL3	Glutathione transferase L3, Gl...		Lus10003994 [exp]	6.0	0.8689
					Lus10034731 [exp]	9.7	0.8948
AT3G10850		GLY2, GLX2-2	GLYOXALASE 2-2, Metallo-hydrol...		Lus10029086 [exp]	11.3	0.8660
AT1G79230		STR1, ATRDH1, A...	ARABIDOPSIS THALIANA RHODANESE...		Lus10031753 [exp]	12.2	0.8474
AT5G16880			Target of Myb protein 1 (.1.2....		Lus10040912 [exp]	12.4	0.8648
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000408 [exp]	18.5	0.8901

Compare expression of checked genes

Lus10034146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.