Lus10034153 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17450 71 / 1e-15 RHA3A RING-H2 finger A3A (.1)
AT5G01880 68 / 8e-15 RING/U-box superfamily protein (.1)
AT3G10910 68 / 2e-14 RING/U-box superfamily protein (.1)
AT1G20823 67 / 7e-14 RING/U-box superfamily protein (.1)
AT4G35480 65 / 3e-13 RHA3B RING-H2 finger A3B (.1)
AT5G06490 65 / 4e-13 RING/U-box superfamily protein (.1)
AT4G09560 66 / 5e-13 NHL22 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT3G48030 66 / 5e-13 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
AT1G22670 65 / 1e-12 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
AT2G35910 64 / 1e-12 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043428 105 / 2e-26 AT5G03730 710 / 0.0 SUGAR-INSENSITIVE 1, CONSTITUTIVE TRIPLE RESPONSE 1, Protein kinase superfamily protein (.1.2)
Lus10008972 86 / 2e-21 AT5G06490 76 / 2e-17 RING/U-box superfamily protein (.1)
Lus10043426 70 / 7e-15 AT4G40070 84 / 5e-19 RING/U-box superfamily protein (.1)
Lus10034157 70 / 1e-14 AT4G40070 84 / 7e-19 RING/U-box superfamily protein (.1)
Lus10028454 66 / 2e-13 AT1G72200 85 / 3e-19 RING/U-box superfamily protein (.1)
Lus10041907 66 / 5e-13 AT4G36050 410 / 6e-135 endonuclease/exonuclease/phosphatase family protein (.1.2)
Lus10009511 65 / 1e-12 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1)
Lus10011702 65 / 1e-12 AT4G28890 231 / 1e-71 RING/U-box superfamily protein (.1)
Lus10012987 65 / 2e-12 AT5G40250 302 / 7e-101 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G243500 81 / 1e-19 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1)
Potri.010G243200 79 / 6e-19 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1)
Potri.010G243300 79 / 1e-18 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1)
Potri.016G067900 77 / 4e-18 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1)
Potri.010G243400 77 / 4e-18 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1)
Potri.006G201500 76 / 1e-17 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Potri.008G019000 76 / 2e-17 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1)
Potri.008G018900 73 / 1e-16 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1)
Potri.002G153400 72 / 1e-15 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1)
Potri.014G076800 71 / 1e-15 AT4G10150 84 / 1e-19 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10034153 pacid=23154817 polypeptide=Lus10034153 locus=Lus10034153.g ID=Lus10034153.BGIv1.0 annot-version=v1.0
ATGACCCATACTAAACCTTCTCCAGATCATGTCCCCAAAGCCTTCCCTTTAGCCTTCGGTGTCGCCGTCGGCTCCCTTTCCCTCCTCGCTATCTTCATCT
GCCTTTGCTGCCTCTTCGTCCGCCGTCGACGACACCCTCGTCCAGTCGCCAGAACCTACTCCGACGCCGACACCGACAACGATTCCGACGTCGCCATTGA
CATGAGCAGTACCGTAAACAATACCGTCGGCGATGAAGACGACCTCAGCCGCTTCCCAAAGCTCATATACAACAGCAACAGTACTAAAATGGAGGGGACC
AATTCCACGTCAGCAGTAGCGTCGGTGGGGTCCAGCAGCAGCTGCGCGATCTGCCTGGCCGACTACTCCGACGGTGACGTCCTCCGGTTGCTCCCTGGGT
GCGGACATTCATTCCACGTGGCCTGTGTGGATCCCTGGCTTGTGAAGAGGAAATCTATCACTTGCCCCATCTGCCGGCGCCAACATTCGCGGCCGGCTGC
CGTGGGTAGTAATAAATAG
AA sequence
>Lus10034153 pacid=23154817 polypeptide=Lus10034153 locus=Lus10034153.g ID=Lus10034153.BGIv1.0 annot-version=v1.0
MTHTKPSPDHVPKAFPLAFGVAVGSLSLLAIFICLCCLFVRRRRHPRPVARTYSDADTDNDSDVAIDMSSTVNNTVGDEDDLSRFPKLIYNSNSTKMEGT
NSTSAVASVGSSSSCAICLADYSDGDVLRLLPGCGHSFHVACVDPWLVKRKSITCPICRRQHSRPAAVGSNK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17450 RHA3A RING-H2 finger A3A (.1) Lus10034153 0 1
AT4G10490 2-oxoglutarate (2OG) and Fe(II... Lus10031150 14.1 0.8362
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Lus10035235 21.2 0.8108
AT3G11320 Nucleotide-sugar transporter f... Lus10028255 21.8 0.8060
AT1G80950 Phospholipid/glycerol acyltran... Lus10032706 22.1 0.8275
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Lus10030323 33.4 0.7991
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10042318 56.0 0.7941
AT1G77860 KOM KOMPEITO, Rhomboid-related int... Lus10003743 64.4 0.7876
AT2G24300 Calmodulin-binding protein (.1... Lus10019056 65.4 0.7879
AT5G18860 NSH3 nucleoside hydrolase 3, inosin... Lus10041249 77.5 0.7851
AT5G61240 Leucine-rich repeat (LRR) fami... Lus10004662 87.9 0.7413

Lus10034153 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.