Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06920 192 / 2e-58 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63320 70 / 8e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G12100 70 / 6e-15 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G62930 67 / 4e-14 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G32630 67 / 4e-14 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G22470 67 / 5e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G19720 66 / 1e-13 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G79540 66 / 1e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G13040 64 / 6e-13 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G63070 64 / 7e-13 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043417 [exp] 247 / 4e-78 AT3G06920 1358 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026558 [exp] 70 / 5e-15 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013841 [exp] 70 / 6e-15 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040633 [exp] 70 / 8e-15 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10023863 [exp] 68 / 3e-14 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10029737 [exp] 65 / 3e-13 AT1G63130 424 / 6e-140 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042452 [exp] 63 / 2e-12 AT1G53330 442 / 1e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003424 [exp] 62 / 3e-12 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1) Lus10021991 [exp] 62 / 4e-12 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G014100 [exp] 204 / 1e-62 AT3G06920 1404 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G025600 [exp] 77 / 2e-17 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G008900 [exp] 76 / 4e-17 AT2G32630 612 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.017G131600 [exp] 71 / 1e-15 AT4G11690 632 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.013G150100 [exp] 71 / 2e-15 AT1G62930 442 / 8e-149 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G032100 [exp] 71 / 2e-15 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G249800 [exp] 71 / 3e-15 AT5G12100 774 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.018G038300 [exp] 69 / 7e-15 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G032600 [exp] 69 / 7e-15 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 69 / 8e-15 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10034167 pacid=23154749 polypeptide=Lus10034167 locus=Lus10034167.g ID=Lus10034167.BGIv1.0 annot-version=v1.0 ATGCAGAAGCAAGGGTTGAAACCCAATACCATCACCTATACTACTATGATCTCAGGACTTGCCAAGGCAGGGAATATCTTTGAGGCTAAAAACCTCTTTG AGAGATTCAAGGCAAATGGAGGTGTACCGGATTCTGCTAGCTACAATGTGATAATAGAAGGCTTAAGCATAGGCAATAGAGCAACGCATGCATATGAGGT GTTTGAGGAAACCAGATCGAAAGGTTTCAACATCCATACCAAGACCTGCGTCGTCCTTTTGGATGCACTACACAAGGCGGAATGCCTTGAACAAGCTGCA ATCGTCGGGGCGGTGCTGAGAGAAACGGCAAAGTCTCAGCATGCTGCAAAACACTGGTAA
AA sequence Show only first row Show all	>Lus10034167 pacid=23154749 polypeptide=Lus10034167 locus=Lus10034167.g ID=Lus10034167.BGIv1.0 annot-version=v1.0 MQKQGLKPNTITYTTMISGLAKAGNIFEAKNLFERFKANGGVPDSASYNVIIEGLSIGNRATHAYEVFEETRSKGFNIHTKTCVVLLDALHKAECLEQAA IVGAVLRETAKSQHAAKHW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06920			Tetratricopeptide repeat (TPR)...		Lus10034167 [exp]	0	1
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10024010 [exp]	5.9	0.8590
AT5G02130		NDP1	Tetratricopeptide repeat (TPR)...		Lus10003964 [exp]	6.0	0.8514
AT1G04950		EMB2781, ATTAF6...	TBP-associated factor 6, EMBRY...		Lus10016578 [exp]	8.4	0.8536
AT5G47790	FHA		SMAD/FHA domain-containing pro...		Lus10003911 [exp]	18.7	0.8502
AT4G38170		FRS9	FAR1-related sequence 9 (.1)		Lus10013855 [exp]	23.2	0.8379
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10017742 [exp]	23.2	0.7923
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10036210 [exp]	27.7	0.8395
AT3G52190		AtPHF1, PHF1	phosphate transporter traffic ...		Lus10038651 [exp]	32.5	0.8489
AT5G22480			ZPR1 zinc-finger domain protei...		Lus10001350 [exp]	33.5	0.7767
AT2G02470	Alfin	AL6	alfin-like 6 (.1.2)		Lus10026268 [exp]	39.3	0.8243

Compare expression of checked genes

Lus10034167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.