Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22280 57 / 1e-12 unknown protein AT3G44280 38 / 3e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043403 [exp] 86 / 9e-24 AT5G22280 127 / 3e-39 unknown protein Lus10016983 [exp] 39 / 2e-05 AT5G22280 76 / 4e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G200200 [exp] 64 / 3e-15 AT5G22280 101 / 3e-29 unknown protein Potri.016G073500 [exp] 46 / 3e-08 AT5G22280 93 / 7e-26 unknown protein Potri.006G206100 [exp] 46 / 4e-08 AT5G22280 72 / 2e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034182 pacid=23154802 polypeptide=Lus10034182 locus=Lus10034182.g ID=Lus10034182.BGIv1.0 annot-version=v1.0 ATGTCGAGGCCTATGTTACTGGTCTTTCTGCTGCTTATACTTATAATCACCTCTCAGTTTGAATGGAGACAGCAACTTGTAAATGACATTGATCCTAGTC CAGCCATAACTGTTAAACAACAACAAATTTCAAAGAGAGAGGAAGCTGTCAAGGAGAAGGTACCATTTTCCTCCTTTATGTGA
AA sequence Show only first row Show all	>Lus10034182 pacid=23154802 polypeptide=Lus10034182 locus=Lus10034182.g ID=Lus10034182.BGIv1.0 annot-version=v1.0 MSRPMLLVFLLLILIITSQFEWRQQLVNDIDPSPAITVKQQQISKREEAVKEKVPFSSFM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22280			unknown protein		Lus10034182 [exp]	0	1
AT3G06720		IMPA1, IMPA-1, ...	importin alpha isoform 1 (.1.2...		Lus10036330 [exp]	4.9	0.8018
AT3G48680		AtCAL2, GAMMACA...	gamma carbonic anhydrase-like ...		Lus10031847 [exp]	8.8	0.8150
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10000007 [exp]	8.8	0.7748
AT1G53280		AtDJ1B	DJ-1 homolog B, Class I glutam...		Lus10009525 [exp]	9.1	0.8088
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10042439 [exp]	10.1	0.7768
AT5G62440			Protein of unknown function (D...		Lus10023594 [exp]	12.6	0.7801
AT5G22040			unknown protein		Lus10000457 [exp]	17.6	0.7671
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Lus10017830 [exp]	19.6	0.6866
AT5G50870		UBC27	ubiquitin-conjugating enzyme 2...		Lus10022248 [exp]	20.2	0.7312
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015864 [exp]	20.2	0.7547

Compare expression of checked genes

Lus10034182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.