Lus10034191 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18970 136 / 4e-40 GLP4 germin-like protein 4 (.1)
AT1G18980 124 / 1e-35 RmlC-like cupins superfamily protein (.1)
AT1G09560 120 / 7e-34 GLP5 germin-like protein 5 (.1)
AT3G04200 116 / 4e-32 RmlC-like cupins superfamily protein (.1)
AT1G02335 114 / 1e-31 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT5G38910 114 / 2e-31 RmlC-like cupins superfamily protein (.1)
AT3G04150 114 / 3e-31 RmlC-like cupins superfamily protein (.1.2)
AT3G05950 113 / 4e-31 RmlC-like cupins superfamily protein (.1)
AT3G10080 113 / 5e-31 RmlC-like cupins superfamily protein (.1)
AT3G62020 112 / 7e-31 GLP10 germin-like protein 10 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043393 310 / 9e-109 AT1G18970 123 / 3e-35 germin-like protein 4 (.1)
Lus10004856 219 / 1e-72 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004854 214 / 1e-70 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004855 214 / 1e-70 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020631 202 / 2e-66 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1)
Lus10020632 202 / 3e-66 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004857 201 / 9e-66 AT1G02335 140 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004858 174 / 7e-55 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10023351 119 / 3e-33 AT3G05950 236 / 5e-79 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G194600 224 / 7e-75 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2)
Potri.009G157100 217 / 4e-72 AT1G09560 105 / 3e-28 germin-like protein 5 (.1)
Potri.010G240500 210 / 3e-69 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240700 207 / 2e-68 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.008G016700 207 / 2e-68 AT1G18980 122 / 6e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240600 206 / 1e-67 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2)
Potri.008G084300 201 / 9e-66 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.013G116500 167 / 1e-52 AT1G18970 70 / 1e-14 germin-like protein 4 (.1)
Potri.011G163216 125 / 8e-36 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163300 125 / 1e-35 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10034191 pacid=23154718 polypeptide=Lus10034191 locus=Lus10034191.g ID=Lus10034191.BGIv1.0 annot-version=v1.0
ATGGCCTCCTTAACAGCGCCTCATCTTCTCAAGTTTTTCTGCATCCTCATGGCTGCATTTTCCATGGCTCAGATGGTAGTAGCTAGTGATCCTGATATCC
TTAGCGACTTCATTCTCCCCGACAGCCAAACCGAGGTGGATGCATCGTTCTTCACTTACACAGGAGCTCGAGGCATTTTGGATTCAGACAACCCTCCTTC
AGTAACAGAAGTGAGCATGGCTGAGTTTCCTGCTCTTAATGGACAAGGTGTTTCCTATGCTGTTCTTCAGTTACCAGCCGGATCTACTTATCCTCCTCAC
AGTCATCCTCGTGCTTCCGAGATCCTTCTTGTCATCCGTGGATGTGTTGAGGTAGGACTTGTCGTAGCAAACAACTGTCTCTACAATCAGACACTGTATG
TCGGGGACATGTTTGTTTTCCCCAAGGGACTTGTTCATTTTGCATTCAATGGTGGGGATGAAGCCGCTACTGCACTTTCTGCATTTGGAAGTGCAAGTCC
AGGAATGGTTTCGCTTCCGGATTCACTTTTCACTAGCAACATCGACGATGCCATCTTGGCTAGTTCCTTCAAGACCAACGTGAACATCATTCAGTCCATT
AAGGATGGTTTTCAGTAA
AA sequence
>Lus10034191 pacid=23154718 polypeptide=Lus10034191 locus=Lus10034191.g ID=Lus10034191.BGIv1.0 annot-version=v1.0
MASLTAPHLLKFFCILMAAFSMAQMVVASDPDILSDFILPDSQTEVDASFFTYTGARGILDSDNPPSVTEVSMAEFPALNGQGVSYAVLQLPAGSTYPPH
SHPRASEILLVIRGCVEVGLVVANNCLYNQTLYVGDMFVFPKGLVHFAFNGGDEAATALSAFGSASPGMVSLPDSLFTSNIDDAILASSFKTNVNIIQSI
KDGFQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18970 GLP4 germin-like protein 4 (.1) Lus10034191 0 1
Lus10034192 1.4 0.9602
AT4G17230 GRAS SCL13 SCARECROW-like 13 (.1) Lus10000539 2.0 0.9515
AT1G14860 ATNUDT18 nudix hydrolase homolog 18 (.1... Lus10021780 2.2 0.9458
AT5G14000 NAC ANAC084 NAC domain containing protein ... Lus10035174 2.8 0.9480
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10012668 3.9 0.9489
AT5G21960 AP2_ERF Integrase-type DNA-binding sup... Lus10038082 6.3 0.9260
AT5G47390 MYB myb-like transcription factor ... Lus10004384 6.5 0.9376
AT2G41010 ATCAMBP25 calmodulin (CAM)-binding prote... Lus10029339 11.5 0.9254
AT4G29780 unknown protein Lus10011946 12.1 0.9277
AT4G16600 Nucleotide-diphospho-sugar tra... Lus10004717 12.6 0.9090

Lus10034191 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.