Lus10034192 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043392 67 / 9e-15 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034192 pacid=23154664 polypeptide=Lus10034192 locus=Lus10034192.g ID=Lus10034192.BGIv1.0 annot-version=v1.0
ATGGTTGGGTTTCCACTCAAATCTTGGGTTCGTTTCTTGCTGCTGCTGCTTACGCTCTTCTTTCTCCTTGCTGCCCCAAGCTTCCAGGACTCCCTCCCAC
TTCAAGCGTGGTGGTGGGAGCCGTGGAGTGTGAGCCGTGGAGGTGGCGGTGGGAGCCGTGGAGGTGGGTGGCGTAGCAGCAGCAGCGGGAAGGGTGGAGG
AGGCATGAAAGGAAAAGGAATAAGTGGACGAGGAAGAGCAATTCCAGTATATGCTGGCGGAGCTGCTGCTGCTGCTGGAGCTCACGGTCACCACCGCAAT
GACGCAGTCCTGATCAATCCTGGGAAGGCCAATCTTGGTCTTTCAATGCTGGTTCTTGCCATCACACTCTTCAAGTATTTTCTTGCATGTTAG
AA sequence
>Lus10034192 pacid=23154664 polypeptide=Lus10034192 locus=Lus10034192.g ID=Lus10034192.BGIv1.0 annot-version=v1.0
MVGFPLKSWVRFLLLLLTLFFLLAAPSFQDSLPLQAWWWEPWSVSRGGGGGSRGGGWRSSSSGKGGGGMKGKGISGRGRAIPVYAGGAAAAAGAHGHHRN
DAVLINPGKANLGLSMLVLAITLFKYFLAC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034192 0 1
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10012668 1.0 0.9684
AT1G18970 GLP4 germin-like protein 4 (.1) Lus10034191 1.4 0.9602
AT5G14000 NAC ANAC084 NAC domain containing protein ... Lus10035174 2.0 0.9506
AT3G19540 Protein of unknown function (D... Lus10028070 3.5 0.9554
AT5G38700 unknown protein Lus10001456 5.5 0.9437
AT2G41010 ATCAMBP25 calmodulin (CAM)-binding prote... Lus10029339 6.7 0.9388
AT4G34410 AP2_ERF RRTF1 (Redox Re... redox responsive transcription... Lus10014054 7.5 0.9419
AT3G54100 O-fucosyltransferase family pr... Lus10021119 7.7 0.9436
AT3G44900 ATCHX4 cation/H+ exchanger 4, cation/... Lus10006166 9.4 0.9043
Lus10025243 9.5 0.9338

Lus10034192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.