Lus10034193 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32300 199 / 1e-59 SD2-5 S-domain-2 5 (.1)
AT5G24080 140 / 9e-40 Protein kinase superfamily protein (.1)
AT2G19130 134 / 2e-36 S-locus lectin protein kinase family protein (.1)
AT1G34300 132 / 6e-36 lectin protein kinase family protein (.1)
AT5G35370 116 / 2e-30 S-locus lectin protein kinase family protein (.1)
AT5G20050 115 / 2e-30 Protein kinase superfamily protein (.1)
AT5G60900 113 / 3e-29 RLK1 receptor-like protein kinase 1 (.1)
AT4G00340 104 / 2e-26 RLK4 receptor-like protein kinase 4 (.1)
AT1G56120 92 / 8e-22 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56130 92 / 9e-22 Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043391 305 / 5e-100 AT4G32300 795 / 0.0 S-domain-2 5 (.1)
Lus10002917 192 / 4e-57 AT4G32300 950 / 0.0 S-domain-2 5 (.1)
Lus10000249 189 / 3e-56 AT4G32300 949 / 0.0 S-domain-2 5 (.1)
Lus10039315 142 / 3e-39 AT5G24080 667 / 0.0 Protein kinase superfamily protein (.1)
Lus10006052 129 / 7e-35 AT1G34300 961 / 0.0 lectin protein kinase family protein (.1)
Lus10013659 120 / 7e-34 AT5G20050 244 / 8e-79 Protein kinase superfamily protein (.1)
Lus10028711 124 / 2e-33 AT1G34300 704 / 0.0 lectin protein kinase family protein (.1)
Lus10033032 120 / 3e-32 AT5G20050 483 / 4e-169 Protein kinase superfamily protein (.1)
Lus10031804 113 / 1e-30 AT5G60900 234 / 2e-71 receptor-like protein kinase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G027300 209 / 1e-63 AT4G32300 1012 / 0.0 S-domain-2 5 (.1)
Potri.006G254600 207 / 4e-63 AT4G32300 965 / 0.0 S-domain-2 5 (.1)
Potri.015G026300 137 / 9e-38 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1)
Potri.019G086200 137 / 1e-37 AT1G34300 918 / 0.0 lectin protein kinase family protein (.1)
Potri.019G086400 137 / 1e-37 AT1G34300 904 / 0.0 lectin protein kinase family protein (.1)
Potri.013G115700 135 / 7e-37 AT1G34300 939 / 0.0 lectin protein kinase family protein (.1)
Potri.013G115800 133 / 3e-36 AT1G34300 858 / 0.0 lectin protein kinase family protein (.1)
Potri.019G086300 129 / 5e-35 AT1G34300 847 / 0.0 lectin protein kinase family protein (.1)
Potri.018G070800 124 / 7e-34 AT5G20050 516 / 0.0 Protein kinase superfamily protein (.1)
Potri.019G119200 117 / 7e-31 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10034193 pacid=23154698 polypeptide=Lus10034193 locus=Lus10034193.g ID=Lus10034193.BGIv1.0 annot-version=v1.0
ATGAACCGCGAGGACAGCGGTGTTTACACGATGGTTCGAGGGACGAGAGGATACTTGGCTCCCGAATGGATATCGAACCATCCCATATCGGAGAAGAGCG
ATGTGTACAGCTACGGCATACTGCTTCTTGAGATAATTGGAGGCAGGAAGAACTACGACTCTGAAGAAAGTTCTGAAAGGTCTCATTTCCCATCGTTCTC
GTTGAAGATGTTCGAAGAAGGGAAGCTGAGAGACATCGTGGATCCAAAGCTGGTGATCGACGATGAAAATGACATCGATGTAATGAATGCAATCAAGATA
GCATTGTGGTGCATTCAGGATGAGATGCAGCTAAGACCACCAATGACTAGAGTAGTCCAAATGCTTCAAGGAATATGCGAGGTTCCTGATCCTCCGATGC
CATCTGAATCGGGCCCTCGGCCTTATACCAACTTCCTCAAGTGGAGTAGCAAAGAGGGGAACAGTTCAGGCTTTAGTAATTACAATTACAACAGCTGCAG
CACGTTTGTGTCTGAGGGTCAGTTATCAGGTCCAAGATAA
AA sequence
>Lus10034193 pacid=23154698 polypeptide=Lus10034193 locus=Lus10034193.g ID=Lus10034193.BGIv1.0 annot-version=v1.0
MNREDSGVYTMVRGTRGYLAPEWISNHPISEKSDVYSYGILLLEIIGGRKNYDSEESSERSHFPSFSLKMFEEGKLRDIVDPKLVIDDENDIDVMNAIKI
ALWCIQDEMQLRPPMTRVVQMLQGICEVPDPPMPSESGPRPYTNFLKWSSKEGNSSGFSNYNYNSCSTFVSEGQLSGPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32300 SD2-5 S-domain-2 5 (.1) Lus10034193 0 1
AT2G39710 Eukaryotic aspartyl protease f... Lus10000514 2.6 0.7986
AT5G42440 Protein kinase superfamily pro... Lus10001120 4.9 0.7969
AT3G14470 NB-ARC domain-containing disea... Lus10000417 5.9 0.7564
AT2G46080 unknown protein Lus10007920 7.7 0.7945
AT1G01550 BPS1 BYPASS 1, Protein of unknown f... Lus10005326 15.9 0.7727
AT5G65520 Tetratricopeptide repeat (TPR)... Lus10012031 16.7 0.7524
AT5G02290 NAK Protein kinase superfamily pro... Lus10023794 20.6 0.7776
AT3G24050 GATA GATA1 GATA transcription factor 1 (.... Lus10023684 20.7 0.7494
AT5G42050 DCD (Development and Cell Deat... Lus10032412 20.9 0.7907
AT2G34200 RING/FYVE/PHD zinc finger supe... Lus10015273 27.9 0.7107

Lus10034193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.