Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27510 107 / 2e-28 Protein kinase superfamily protein (.1) AT3G46140 103 / 1e-26 Protein kinase superfamily protein (.1) AT4G36950 102 / 3e-26 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1) AT2G05060 100 / 5e-26 Protein kinase superfamily protein (.1) AT3G45790 101 / 6e-26 Protein kinase superfamily protein (.1) AT2G34290 98 / 2e-25 Protein kinase superfamily protein (.1) AT2G41920 97 / 1e-24 Protein kinase superfamily protein (.1) AT3G50310 96 / 6e-24 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) AT2G41910 91 / 4e-22 Protein kinase superfamily protein (.1) AT5G67080 90 / 1e-21 MAPKKK19 mitogen-activated protein kinase kinase kinase 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034242 [exp] 176 / 6e-55 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10026894 [exp] 172 / 8e-54 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10034288 [exp] 159 / 1e-48 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10034285 [exp] 149 / 1e-44 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1) Lus10039141 [exp] 146 / 2e-43 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1) Lus10034246 [exp] 118 / 1e-33 AT4G36950 107 / 7e-28 mitogen-activated protein kinase kinase kinase 21 (.1) Lus10029023 [exp] 115 / 2e-32 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Lus10013791 [exp] 115 / 4e-32 AT3G45790 108 / 1e-28 Protein kinase superfamily protein (.1) Lus10017114 [exp] 114 / 4e-31 AT3G50310 127 / 3e-34 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G131100 [exp] 103 / 4e-27 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Potri.001G042400 [exp] 104 / 5e-27 AT3G50310 236 / 5e-75 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Potri.005G139200 [exp] 98 / 8e-25 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.003G184200 [exp] 99 / 1e-24 AT4G36950 246 / 8e-79 mitogen-activated protein kinase kinase kinase 21 (.1) Potri.006G181000 [exp] 96 / 4e-24 AT3G45670 213 / 4e-66 Protein kinase superfamily protein (.1) Potri.007G044800 [exp] 93 / 9e-23 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.004G171500 [exp] 91 / 3e-22 AT3G50310 202 / 7e-63 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1) Potri.005G139300 [exp] 85 / 5e-20 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1) Potri.018G050800 [exp] 75 / 4e-16 AT4G29810 540 / 0.0 MAP KINASE KINASE 1, MAP kinase kinase 2 (.1.2.3) Potri.006G146500 [exp] 73 / 1e-15 AT4G29810 495 / 7e-177 MAP KINASE KINASE 1, MAP kinase kinase 2 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10034216 pacid=23176122 polypeptide=Lus10034216 locus=Lus10034216.g ID=Lus10034216.BGIv1.0 annot-version=v1.0 ATGGCCGTCAAATCCTCGCCGGAGAACAGAGCATCTTCTCCGCTGACCGACCACTTCATCCTCCAGAGGGTCCGCGGCGCTCCGGGGATAATCCAGTGCT CCAGAATTAGCATCTCCCGCGAAATTCAATATGGTCCGGCAACTTACAATCTGTTTCTTGAATATGCCGCGGGTGGCTCTCTCTCCGACTTAATCGCTGA CCACCGCCGAAAAACACGTGGAAGAATCGGACTGCCGGAGAGGAATGTAAAGTTCTTTACTTTGATGCTACTGAGAGCGATCTACACCGTCCACTCGCGC GGAATCACCCACTGCGACATCAAGCCGGCGAACATTCTGGTCTTTCCGATGGGGGAGCTGAAGATTGGCGATTTCGGGCTGGCGGCGGAGAGCCGGACGA TACGTCCGACGGGAAGGGACTTCAGGGGAACGGTCAGGTACCTTCCGCCGGATATTATTTGGCTGGGGAAGGTGTCCCCGGCGATGGATAGATGGGTTTG GGGTGTAGTGTGA
AA sequence Show only first row Show all	>Lus10034216 pacid=23176122 polypeptide=Lus10034216 locus=Lus10034216.g ID=Lus10034216.BGIv1.0 annot-version=v1.0 MAVKSSPENRASSPLTDHFILQRVRGAPGIIQCSRISISREIQYGPATYNLFLEYAAGGSLSDLIADHRRKTRGRIGLPERNVKFFTLMLLRAIYTVHSR GITHCDIKPANILVFPMGELKIGDFGLAAESRTIRPTGRDFRGTVRYLPPDIIWLGKVSPAMDRWVWGVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27510			Protein kinase superfamily pro...		Lus10034216 [exp]	0	1
AT4G32480			Protein of unknown function (D...		Lus10033683 [exp]	1.0	0.9528
AT4G26400			RING/U-box superfamily protein...		Lus10043027 [exp]	11.3	0.9447
AT5G03860		MLS	malate synthase (.1.2)		Lus10020565 [exp]	18.2	0.9301
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10039830 [exp]	18.5	0.9237
AT1G27150			Tetratricopeptide repeat (TPR)...		Lus10037232 [exp]	21.7	0.9331
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10030799 [exp]	22.7	0.8784
AT5G46060			Protein of unknown function, D...		Lus10013943 [exp]	24.1	0.9216
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Lus10022441 [exp]	26.8	0.9229
AT5G53110			RING/U-box superfamily protein...		Lus10032382 [exp]	27.6	0.9254
AT2G45510		CYP704A2	"cytochrome P450, family 704, ...		Lus10015018 [exp]	30.7	0.9297

Compare expression of checked genes

Lus10034216 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.