Lus10034217 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67080 60 / 1e-11 MAPKKK19 mitogen-activated protein kinase kinase kinase 19 (.1)
AT3G50310 59 / 2e-11 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
AT3G06030 59 / 5e-11 AtANP3, MAPKKK12, ANP3 NPK1-related protein kinase 3 (.1)
AT5G55090 58 / 6e-11 MAPKKK15 mitogen-activated protein kinase kinase kinase 15 (.1)
AT4G26890 58 / 6e-11 MAPKKK16 mitogen-activated protein kinase kinase kinase 16 (.1)
AT1G54960 53 / 5e-09 MAPKKK2, ANP2 MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASES 2, NPK1-related protein kinase 2 (.1)
AT2G32510 52 / 5e-09 MAPKKK17 mitogen-activated protein kinase kinase kinase 17 (.1)
AT4G36950 50 / 4e-08 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1)
AT4G12020 50 / 5e-08 WRKY MEKK4, MAPKKK11, ATWRKY19, WRKY19 MAPK/ERK KINASE KINASE 4, MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 11, protein kinase family protein (.1.2.3)
AT1G09000 49 / 6e-08 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029047 171 / 7e-56 AT3G50310 93 / 5e-23 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10026894 93 / 5e-24 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034242 87 / 2e-21 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029019 83 / 2e-21 AT3G50310 96 / 3e-24 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029023 83 / 1e-20 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034288 82 / 1e-19 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034246 80 / 1e-19 AT4G36950 107 / 7e-28 mitogen-activated protein kinase kinase kinase 21 (.1)
Lus10031963 78 / 1e-19 AT3G06030 87 / 1e-21 NPK1-related protein kinase 3 (.1)
Lus10034285 80 / 8e-19 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G149500 54 / 2e-09 AT3G06030 681 / 0.0 NPK1-related protein kinase 3 (.1)
Potri.003G184200 54 / 2e-09 AT4G36950 246 / 8e-79 mitogen-activated protein kinase kinase kinase 21 (.1)
Potri.014G035500 54 / 2e-09 AT5G66850 453 / 4e-149 mitogen-activated protein kinase kinase kinase 5 (.1)
Potri.005G139300 53 / 3e-09 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.010G092000 52 / 6e-09 AT3G06030 698 / 0.0 NPK1-related protein kinase 3 (.1)
Potri.013G022700 52 / 6e-09 AT1G09000 713 / 0.0 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Potri.001G042400 52 / 6e-09 AT3G50310 236 / 5e-75 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.005G033400 52 / 7e-09 AT1G09000 680 / 0.0 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Potri.002G129100 52 / 1e-08 AT5G66850 441 / 5e-145 mitogen-activated protein kinase kinase kinase 5 (.1)
Potri.009G131100 52 / 1e-08 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
PFAM info
Representative CDS sequence
>Lus10034217 pacid=23176090 polypeptide=Lus10034217 locus=Lus10034217.g ID=Lus10034217.BGIv1.0 annot-version=v1.0
ATGCTGACCGGAAGCCTGCCGTGGAGTGATTTGAAGCAGGAAAAGGATTTGATGAGCATGATCGGAAAGGGAGGTCAGCCGAAGATTCCGGAGTGGGTTT
CCGAAGAAGGGAAGGATTTTCTGAACAAGTGCTGTATTAGGGGTTCAGAGCTGCGTTTTCCGGCTGAATTGGTTATGCAACATCCGTTCGTCACCGGCGG
GAGGATCTCGACGGCGGTGATCGGACCAAGAGGAAGGAATTGGAGTGTTGGCCGGGAAACAAGGGCAGCGCCGGAGCAGAGGTCCCCTGCTGCTGCTGCT
GTTTACACCTTGTTTCCTCCTAATCAAGCTGCTTTAGTCGCACTTTGA
AA sequence
>Lus10034217 pacid=23176090 polypeptide=Lus10034217 locus=Lus10034217.g ID=Lus10034217.BGIv1.0 annot-version=v1.0
MLTGSLPWSDLKQEKDLMSMIGKGGQPKIPEWVSEEGKDFLNKCCIRGSELRFPAELVMQHPFVTGGRISTAVIGPRGRNWSVGRETRAAPEQRSPAAAA
VYTLFPPNQAALVAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67080 MAPKKK19 mitogen-activated protein kina... Lus10034217 0 1
AT2G24430 NAC ANAC039, ANAC03... Arabidopsis NAC domain contain... Lus10026966 5.5 0.8803
AT4G29820 CFIM-25, ATCFIM... ARABIDOPSIS THALIANA HOMOLOG O... Lus10027624 5.7 0.9122
Lus10011203 13.0 0.8458
AT5G08240 unknown protein Lus10040984 29.7 0.8821
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10008291 33.1 0.8835
AT4G33495 RPD1 ROOT PRIMORDIUM DEFECTIVE 1, U... Lus10005755 33.6 0.8787
AT3G53200 MYB ATMYB27 myb domain protein 27 (.1) Lus10023918 37.1 0.8729
AT5G64530 NAC ANAC104, XND1 Arabidopsis NAC domain contain... Lus10010747 40.6 0.8756
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10019030 47.0 0.8134
AT5G55250 AtIAMT1, IAMT1 IAA carboxylmethyltransferase ... Lus10043177 52.9 0.8531

Lus10034217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.