Lus10034220 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56330 94 / 1e-22 N2,N2-dimethylguanosine tRNA methyltransferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029044 121 / 1e-32 AT3G56330 508 / 5e-179 N2,N2-dimethylguanosine tRNA methyltransferase (.1)
Lus10012884 107 / 9e-28 AT3G56330 431 / 4e-150 N2,N2-dimethylguanosine tRNA methyltransferase (.1)
Lus10030535 95 / 5e-23 AT3G56330 548 / 0.0 N2,N2-dimethylguanosine tRNA methyltransferase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G093500 93 / 2e-22 AT3G56330 533 / 0.0 N2,N2-dimethylguanosine tRNA methyltransferase (.1)
PFAM info
Representative CDS sequence
>Lus10034220 pacid=23176128 polypeptide=Lus10034220 locus=Lus10034220.g ID=Lus10034220.BGIv1.0 annot-version=v1.0
ATGGGAACTTTTAGTTCACTGGATGCATATGGAGCATACGTTTGTCCAATGCCATTCCCGAACGAAATCGGTTTGAGAGTGCTTATAGGGGGGGCAGTTC
GAGAAGCGGCGGTTCTAGGCTATCAAGTCACGCCACTGTTCTCATACTACGCCGCCCATGGACCAGTTTACAGAGGATGGATTGGAAACTGTGAAGGAGC
TAACCTGGAAAAGCTTTTGAATGGGATGATAGATGAAAGCGACCCGAGATTACCACCGGGATACATCAAACTAGACGAGGTTCGTGCATATTTCCTTCCA
CCTCTGGTTGGTTTCTCTACACTGTCCAATAAACTTTTCCAGTTCCTCTTGCGTTTTCCAGATGACAAGCCGAGCGAAAATCGATTGCCCTCCGTTGAAA
ACACTGATGAGCAACTTGCATACGCTAGCAGGACGCACATTGTCTCGAATGCGATCAAAACCAACTGTCCGATGACGGACTTCATCAAGCTTGCTAAGGA
ACTCATGGGCATCCCTGTTAATTTAGGAACATAG
AA sequence
>Lus10034220 pacid=23176128 polypeptide=Lus10034220 locus=Lus10034220.g ID=Lus10034220.BGIv1.0 annot-version=v1.0
MGTFSSLDAYGAYVCPMPFPNEIGLRVLIGGAVREAAVLGYQVTPLFSYYAAHGPVYRGWIGNCEGANLEKLLNGMIDESDPRLPPGYIKLDEVRAYFLP
PLVGFSTLSNKLFQFLLRFPDDKPSENRLPSVENTDEQLAYASRTHIVSNAIKTNCPMTDFIKLAKELMGIPVNLGT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G56330 N2,N2-dimethylguanosine tRNA m... Lus10034220 0 1
Lus10027601 11.0 0.5371
AT2G18470 AtPERK4, PERK4 proline-rich extensin-like rec... Lus10026027 11.4 0.5184
AT1G16290 unknown protein Lus10037104 15.7 0.5706
Lus10014737 19.4 0.4949
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 21.2 0.4949
AT4G16195 Plant self-incompatibility pro... Lus10019768 22.9 0.4949
Lus10021773 24.5 0.4949
AT4G27170 SESA4, AT2S4 seed storage albumin 4 (.1) Lus10040395 26.0 0.4949
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 27.4 0.4949
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10035900 28.7 0.4949

Lus10034220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.