Lus10034223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56340 130 / 4e-40 Ribosomal protein S26e family protein (.1)
AT2G40590 129 / 2e-39 Ribosomal protein S26e family protein (.1)
AT2G40510 129 / 2e-39 Ribosomal protein S26e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029042 162 / 2e-52 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1)
Lus10030533 154 / 2e-49 AT2G40510 185 / 1e-61 Ribosomal protein S26e family protein (.1)
Lus10012883 159 / 3e-48 AT3G10920 356 / 1e-123 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G057000 143 / 5e-45 AT3G56340 132 / 6e-41 Ribosomal protein S26e family protein (.1)
Potri.013G093700 140 / 4e-44 AT3G56340 130 / 3e-40 Ribosomal protein S26e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01283 Ribosomal_S26e Ribosomal protein S26e
Representative CDS sequence
>Lus10034223 pacid=23175911 polypeptide=Lus10034223 locus=Lus10034223.g ID=Lus10034223.BGIv1.0 annot-version=v1.0
ATGCCTTTCAAGCGTAGGAACGGAGGTCGCAACAAGCAGGGACGCGGCCACACGAAGTTCATCCGCTGCTCCAACTGCGGCAAATGCTGCCCTAAGGACA
AGGCGATCAAGAGATTCCTTGTGAGGAACATTGTCGAGCAGGCTGCTGTTAGAGATGTTCAGGAGTCATGCGTCTTTGATGGATATGTTCTCCCAAAGCT
ATATGTTAAGATGCAGTACTGCGTCTCATGTGCCATCCACTCTCGCGTTGTGAGGGTCCGATCAAGCACTGATCGTAGGAAGCGTGACCCACCCCAGCGT
TTCCAGAGGCGCAAGGAGGATGCTAAGCCTGGTCAAGGTGGACCTGCTGGTCCTGGTGCTCGCCCTGGTGCTCCTCCAGTTGCTGCCCGTGCTTAA
AA sequence
>Lus10034223 pacid=23175911 polypeptide=Lus10034223 locus=Lus10034223.g ID=Lus10034223.BGIv1.0 annot-version=v1.0
MPFKRRNGGRNKQGRGHTKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQESCVFDGYVLPKLYVKMQYCVSCAIHSRVVRVRSSTDRRKRDPPQR
FQRRKEDAKPGQGGPAGPGARPGAPPVAARA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40510 Ribosomal protein S26e family ... Lus10034223 0 1
AT5G04430 BTR1S, BTR1L, B... BINDING TO TOMV RNA 1S \(SHORT... Lus10037932 1.7 0.9656
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10031704 2.4 0.9658
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10013183 2.8 0.9725
AT1G09690 Translation protein SH3-like f... Lus10029302 3.2 0.9607
AT3G57290 ATINT6, ATEIF3E... eukaryotic translation initiat... Lus10018035 4.0 0.9611
AT1G80670 RAE1 RNA export factor 1, Transduci... Lus10002323 4.9 0.9561
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10027192 6.0 0.9609
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10038908 6.6 0.9562
AT4G01560 MEE49 maternal effect embryo arrest ... Lus10030171 6.7 0.9539
AT5G55130 SIR1, CNX5 SIRTINOL RESISTANT 1, "co-fact... Lus10022510 7.1 0.9524

Lus10034223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.