Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01880 46 / 6e-07 RING/U-box superfamily protein (.1) AT1G49230 45 / 2e-06 RING/U-box superfamily protein (.1) AT5G05280 41 / 4e-05 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029037 [exp] 93 / 9e-25 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1) Lus10005817 [exp] 40 / 0.0001 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1) Lus10022743 [exp] 40 / 0.0001 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10006785 [exp] 40 / 0.0002 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1) Lus10006788 [exp] 39 / 0.0004 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1) Lus10005814 [exp] 38 / 0.0007 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G091300 [exp] 78 / 9e-19 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.019G057700 [exp] 73 / 6e-17 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1) Potri.016G136200 [exp] 49 / 1e-07 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.019G130100 [exp] 45 / 1e-06 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 45 / 1e-06 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 40 / 0.0001 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.013G157000 [exp] 38 / 0.0005 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034228 pacid=23175976 polypeptide=Lus10034228 locus=Lus10034228.g ID=Lus10034228.BGIv1.0 annot-version=v1.0 ATGGAGATTGCTAGCCTCCACCGTGGTCGTCCTCACCGGCTCCTTCTCGAAATCCAAACGACAATCGGCTCGCCGCCTTCCGCCAGCGGCGGCGGCGGTT ACAACAGGGATGCTAATTTCGACGCGAACATGGTGATCATCCTGGCGGCGCTGCTATGCGCTCTGATCTGCGCGCTGGGGCTCAACTCGATCGTGAGGTG TGCGCTCCGATGCAACCGGAGGTTGGCGTTTGAGGATCCCGGCGGGGAACGGATGGCGGAGACGGCGGCGGGGCTGAAGAAGAGCGCTTTACGTTGGCGT ACGTGCCGGAGGGCGTTGCTGGATGCGCCGGCGGCGGTGTTGGTGGACGGTGATGGAAGTACTGGGGCAGGGGAAGAGTTGGGTTAA
AA sequence Show only first row Show all	>Lus10034228 pacid=23175976 polypeptide=Lus10034228 locus=Lus10034228.g ID=Lus10034228.BGIv1.0 annot-version=v1.0 MEIASLHRGRPHRLLLEIQTTIGSPPSASGGGGYNRDANFDANMVIILAALLCALICALGLNSIVRCALRCNRRLAFEDPGGERMAETAAGLKKSALRWR TCRRALLDAPAAVLVDGDGSTGAGEELG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05280			RING/U-box superfamily protein...		Lus10034228 [exp]	0	1
AT5G48485		DIR1	DEFECTIVE IN INDUCED RESISTANC...		Lus10039511 [exp]	1.0	0.9675
AT1G15960		ATNRAMP6, NRAMP...	NRAMP metal ion transporter 6 ...		Lus10024069 [exp]	3.0	0.9166
AT3G10910			RING/U-box superfamily protein...		Lus10029037 [exp]	3.5	0.9274
AT1G21065			unknown protein		Lus10016049 [exp]	4.5	0.9067
					Lus10003132 [exp]	5.0	0.9057
					Lus10028522 [exp]	7.0	0.9039
AT1G58340		BCD1, ZRZ, ZF14	ZRIZI, BUSH-AND-CHLOROTIC-DWAR...		Lus10007231 [exp]	7.3	0.9055
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Lus10013384 [exp]	12.3	0.8973
AT2G22790			unknown protein		Lus10011575 [exp]	15.5	0.8584
AT2G25625			unknown protein		Lus10013129 [exp]	18.0	0.8830

Compare expression of checked genes

Lus10034228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.