Lus10034248 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05220 85 / 2e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029015 241 / 6e-84 AT5G05220 77 / 1e-18 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G090200 99 / 2e-27 AT5G05220 75 / 2e-17 unknown protein
PFAM info
Representative CDS sequence
>Lus10034248 pacid=23176041 polypeptide=Lus10034248 locus=Lus10034248.g ID=Lus10034248.BGIv1.0 annot-version=v1.0
ATGGGAACTTTTGCCTTAGTTTCTTACCCTGCAGCGCCATCTCCAACCATCAACACCTCTCTTCTTCCTTCAAGATCCAACCTTTATCCACCTGCAACTC
AACCAATCCTCCCAACAAGAAGGAAATTTCATCTCAACTGTGCCAAGCTGAGCCCTACTCAGTCTCGCTACCCAGATCATGAGCAAGAATGGATGGATGT
GGAATTTGGGAAACTGGTGAAGGAGAAATGCAGAGAGAGGAAAGGAGTGGTGGAGCTGTTGGAATGCCTTGAGACTGAAGCAATCATGGGAGATGATGAA
GGTAAAGACCCTACTGATTATAATCGCAGAGCACAGATCTTTGACAGAAGCTCCAAAGTTTTCCAGTCTCTCAAGGAACAGCAAAACCAACAACCGTAA
AA sequence
>Lus10034248 pacid=23176041 polypeptide=Lus10034248 locus=Lus10034248.g ID=Lus10034248.BGIv1.0 annot-version=v1.0
MGTFALVSYPAAPSPTINTSLLPSRSNLYPPATQPILPTRRKFHLNCAKLSPTQSRYPDHEQEWMDVEFGKLVKEKCRERKGVVELLECLETEAIMGDDE
GKDPTDYNRRAQIFDRSSKVFQSLKEQQNQQP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05220 unknown protein Lus10034248 0 1
Lus10019580 7.2 0.8129
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10039830 12.0 0.8898
AT3G11080 AtRLP35 receptor like protein 35 (.1) Lus10028053 12.3 0.8053
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10031234 18.7 0.8108
AT1G29680 Protein of unknown function (D... Lus10005415 19.0 0.8626
Lus10000456 19.3 0.7595
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10031046 30.5 0.8400
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 33.8 0.8108
AT5G52790 CBS domain-containing protein ... Lus10039288 36.4 0.7878
AT2G40170 GEA6, ATEM6 LATE EMBRYOGENESIS ABUNDANT 6,... Lus10030394 38.8 0.7543

Lus10034248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.