Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68765 44 / 5e-07 IDA INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) AT3G25655 39 / 3e-05 IDL1 inflorescence deficient in abscission (IDA)-like 1 (.1) AT5G64667 38 / 0.0001 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034385 [exp] 159 / 1e-52 AT1G68765 44 / 5e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10005811 [exp] 36 / 0.0006 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G114600 [exp] 91 / 2e-25 AT1G68765 46 / 5e-08 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.010G131500 [exp] 82 / 6e-22 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.005G189900 [exp] 40 / 1e-05 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.007G110700 [exp] 39 / 3e-05 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G057400 [exp] 39 / 5e-05 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 38 / 6e-05 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.013G074000 [exp] 38 / 7e-05 AT1G68765 43 / 7e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034260 pacid=23175904 polypeptide=Lus10034260 locus=Lus10034260.g ID=Lus10034260.BGIv1.0 annot-version=v1.0 ATGGCGGCATCGAGCTCTTCATCATCAACGTCTTCAGTTTTCCTGGTCGGGGTGATTATCGCTCTGTTCCTGCTCATTGCTTCATGCTCTGCCACCAGAC CAGGAGCTATGTTATTAGTGGAGGACGGTCCAAAGGCACCCGGAAACGACGTCGTCGGAAGCGGTCGGAAACTGTACCTGAAAGCGTTCCAGTTGGACGG TCAACAATTCAACTTCTTGCCCAAAGGGGTTCCGATTCCGCCCTCCGGTCCCTCCAAACAACACAACTCTGTGGAGAACTGA
AA sequence Show only first row Show all	>Lus10034260 pacid=23175904 polypeptide=Lus10034260 locus=Lus10034260.g ID=Lus10034260.BGIv1.0 annot-version=v1.0 MAASSSSSSTSSVFLVGVIIALFLLIASCSATRPGAMLLVEDGPKAPGNDVVGSGRKLYLKAFQLDGQQFNFLPKGVPIPPSGPSKQHNSVEN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68765		IDA	INFLORESCENCE DEFICIENT IN ABS...		Lus10034260 [exp]	0	1
AT3G22060			Receptor-like protein kinase-r...		Lus10027145 [exp]	4.2	0.8624
AT3G02130		TOAD2, RPK2, CL...	TOADSTOOL 2, clv3 peptide inse...		Lus10026666 [exp]	4.6	0.8965
AT2G15220			Plant basic secretory protein ...		Lus10019806 [exp]	8.3	0.8753
AT3G48990			AMP-dependent synthetase and l...		Lus10027477 [exp]	8.8	0.8903
AT5G01750			Protein of unknown function (D...		Lus10002477 [exp]	15.0	0.8540
AT5G20910		AIP2	ABI3-interacting protein 2, RI...		Lus10034667 [exp]	15.3	0.8510
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10009717 [exp]	16.2	0.8727
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10011013 [exp]	20.7	0.8324
AT3G02130		TOAD2, RPK2, CL...	TOADSTOOL 2, clv3 peptide inse...		Lus10004646 [exp]	23.0	0.8288
AT4G20820			FAD-binding Berberine family p...		Lus10032943 [exp]	23.7	0.8686

Compare expression of checked genes

Lus10034260 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.