Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21580 140 / 7e-45 Ribosomal protein S25 family protein (.1.2) AT4G39200 140 / 2e-44 Ribosomal protein S25 family protein (.1.2) AT4G34555 138 / 1e-43 Ribosomal protein S25 family protein (.1) AT2G16360 129 / 4e-40 Ribosomal protein S25 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021706 [exp] 150 / 2e-48 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10035060 [exp] 150 / 2e-48 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10023552 [exp] 146 / 5e-47 AT4G39200 169 / 7e-56 Ribosomal protein S25 family protein (.1.2) Lus10040436 [exp] 135 / 6e-43 AT4G39200 130 / 3e-41 Ribosomal protein S25 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G020000 [exp] 141 / 4e-45 AT4G34555 132 / 2e-41 Ribosomal protein S25 family protein (.1) Potri.010G239300 [exp] 140 / 1e-44 AT4G39200 131 / 6e-41 Ribosomal protein S25 family protein (.1.2) Potri.004G157200 [exp] 140 / 2e-44 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.009G118900 [exp] 140 / 2e-44 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF03297 [flax] [poplar] Ribosomal_S25 S25 ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10034277 pacid=23175930 polypeptide=Lus10034277 locus=Lus10034277.g ID=Lus10034277.BGIv1.0 annot-version=v1.0 ATGGCTCCAAAGAAGGCAGCTCCGCCGCCGTCGTCGAAGCCGGCCAAGTCCGGTGGAGGGAAGCAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAAAGG AGAAGGTCAACAACATGGTTCTCTTTGACCAGGCTACCTATGACAAGCTGCTCTCTGAAGCTCCCAAGTACAAGCACATCACTCCCTCCATCCTCTCCGA TCGCCTCAGGGTGAATGGATCTCTGGCGAGGAAGGCAATTAAGGAGCTGATGGCAAAAGGTTTGATCAGGATGGTTTCTGCACATGCAAGCCAGCAGATC TACACCAGGGCAACCAACACCTAA
AA sequence Show only first row Show all	>Lus10034277 pacid=23175930 polypeptide=Lus10034277 locus=Lus10034277.g ID=Lus10034277.BGIv1.0 annot-version=v1.0 MAPKKAAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKYKHITPSILSDRLRVNGSLARKAIKELMAKGLIRMVSAHASQQI YTRATNT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21580			Ribosomal protein S25 family p...		Lus10034277 [exp]	0	1
AT1G09590			Translation protein SH3-like f...		Lus10021079 [exp]	1.7	0.8827
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	4.7	0.8761
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10024913 [exp]	7.1	0.8409
AT2G38730			Cyclophilin-like peptidyl-prol...		Lus10008662 [exp]	10.0	0.8339
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10005348 [exp]	11.2	0.8546
AT5G67500		VDAC2, ATVDAC2	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10018683 [exp]	11.5	0.8369
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Lus10022810 [exp]	14.1	0.8549
AT2G28740		HIS4	histone H4 (.1)		Lus10025964 [exp]	15.5	0.8723
AT3G07590			Small nuclear ribonucleoprotei...		Lus10025186 [exp]	16.2	0.8346
AT3G53730			Histone superfamily protein (....		Lus10040849 [exp]	20.5	0.8477

Compare expression of checked genes

Lus10034277 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.