Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17850 75 / 3e-17 Sodium/calcium exchanger family protein (.1) AT5G17860 64 / 2e-13 CAX7 calcium exchanger 7 (.1) AT1G54115 64 / 3e-13 ATCCX4 cation calcium exchanger 4 (.1) AT3G14070 62 / 1e-12 ATCCX3, CAX9 CATION CALCIUM EXCHANGER 3, cation exchanger 9 (.1) AT1G08960 55 / 2e-10 CCX5, AtCXX5, ATCAX11, CAX11 cation calcium exchanger 5, Arabidopsis thaliana cation calcium exchanger 5, cation exchanger 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005673 [exp] 95 / 3e-24 AT5G17850 346 / 7e-114 Sodium/calcium exchanger family protein (.1) Lus10020318 [exp] 95 / 4e-24 AT5G17850 464 / 2e-157 Sodium/calcium exchanger family protein (.1) Lus10001329 [exp] 92 / 2e-23 AT5G17850 505 / 8e-174 Sodium/calcium exchanger family protein (.1) Lus10013634 [exp] 92 / 3e-23 AT5G17850 512 / 4e-177 Sodium/calcium exchanger family protein (.1) Lus10013635 [exp] 76 / 2e-17 AT5G17860 540 / 0.0 calcium exchanger 7 (.1) Lus10001330 [exp] 74 / 8e-17 AT5G17860 552 / 0.0 calcium exchanger 7 (.1) Lus10015668 [exp] 60 / 8e-12 AT1G54115 484 / 8e-168 cation calcium exchanger 4 (.1) Lus10037682 [exp] 60 / 8e-12 AT1G54115 758 / 0.0 cation calcium exchanger 4 (.1) Lus10037681 [exp] 59 / 9e-12 AT1G54115 763 / 0.0 cation calcium exchanger 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G065900 [exp] 84 / 2e-20 AT5G17850 508 / 1e-175 Sodium/calcium exchanger family protein (.1) Potri.019G040301 [exp] 82 / 7e-20 AT5G17850 393 / 2e-131 Sodium/calcium exchanger family protein (.1) Potri.013G065800 [exp] 72 / 2e-16 AT5G17860 420 / 9e-141 calcium exchanger 7 (.1) Potri.019G040200 [exp] 69 / 4e-15 AT5G17860 449 / 2e-152 calcium exchanger 7 (.1) Potri.003G066900 [exp] 60 / 4e-12 AT1G54115 802 / 0.0 cation calcium exchanger 4 (.1) Potri.001G167200 [exp] 59 / 7e-12 AT1G54115 811 / 0.0 cation calcium exchanger 4 (.1) Potri.013G025100 [exp] 50 / 1e-08 AT1G08960 603 / 0.0 cation calcium exchanger 5, Arabidopsis thaliana cation calcium exchanger 5, cation exchanger 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01699 [flax] [poplar] Na_Ca_ex Sodium/calcium exchanger protein
Representative CDS sequence Show only first row Show all	>Lus10034284 pacid=23176026 polypeptide=Lus10034284 locus=Lus10034284.g ID=Lus10034284.BGIv1.0 annot-version=v1.0 ATGGCTAGCGGGAGGCTTCTTGATGAGCGTAACGTGGAGCTACATCATGGCGCAAGAATTGGTAGCGTTGCTCGTGTCGACAGGCTACATTTTATGGGGC TAACCGTACTCGGGTGGGGCAACTTGATCTCGAATTTGATAACCAATTGGACAATGGGTATCAATGGTAGGCCTGAAGGTGTGCAAGTGGCCATATCAGG GTGTTATGCAGGGCCAATCTTCAACATCCTGTTTGGACTCGGATTATCCTGGGTTGGTTCTTGA
AA sequence Show only first row Show all	>Lus10034284 pacid=23176026 polypeptide=Lus10034284 locus=Lus10034284.g ID=Lus10034284.BGIv1.0 annot-version=v1.0 MASGRLLDERNVELHHGARIGSVARVDRLHFMGLTVLGWGNLISNLITNWTMGINGRPEGVQVAISGCYAGPIFNILFGLGLSWVGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17850			Sodium/calcium exchanger famil...		Lus10034284 [exp]	0	1
AT3G13690			Protein kinase protein with ad...		Lus10009559 [exp]	4.5	0.9477
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Lus10002384 [exp]	5.9	0.8100
					Lus10003825 [exp]	6.3	0.9465
					Lus10008923 [exp]	6.7	0.7780
AT5G56990			unknown protein		Lus10029528 [exp]	7.7	0.9465
					Lus10038051 [exp]	8.9	0.9465
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	10.0	0.9465
AT5G57750			RING/U-box superfamily protein...		Lus10016542 [exp]	10.1	0.8107
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	11.0	0.9465
					Lus10029261 [exp]	11.8	0.9465

Compare expression of checked genes

Lus10034284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.