Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50300 90 / 1e-22 ATAZG2 ARABIDOPSIS THALIANA AZA-GUANINE RESISTANT2, Xanthine/uracil permease family protein (.1) AT3G10960 61 / 2e-12 ATAZG1 AZA-guanine resistant1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040894 [exp] 110 / 1e-29 AT5G50300 691 / 0.0 ARABIDOPSIS THALIANA AZA-GUANINE RESISTANT2, Xanthine/uracil permease family protein (.1) Lus10009102 [exp] 64 / 3e-13 AT3G10960 780 / 0.0 AZA-guanine resistant1 (.1) Lus10025246 [exp] 62 / 1e-12 AT3G10960 780 / 0.0 AZA-guanine resistant1 (.1) Lus10012895 [exp] 58 / 3e-11 AT3G10960 873 / 0.0 AZA-guanine resistant1 (.1) Lus10030548 [exp] 58 / 4e-11 AT3G10960 881 / 0.0 AZA-guanine resistant1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G090000 [exp] 103 / 2e-27 AT5G50300 736 / 0.0 ARABIDOPSIS THALIANA AZA-GUANINE RESISTANT2, Xanthine/uracil permease family protein (.1) Potri.013G083300 [exp] 57 / 7e-11 AT3G10960 903 / 0.0 AZA-guanine resistant1 (.1) Potri.016G133800 [exp] 54 / 6e-10 AT3G10960 847 / 0.0 AZA-guanine resistant1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034287 pacid=23176050 polypeptide=Lus10034287 locus=Lus10034287.g ID=Lus10034287.BGIv1.0 annot-version=v1.0 ATGAAAGTGGTGAAGGACATTGATTGGGGTGGTTTGAAGGAAGGTGTGCCTGCGTTTTTCACGATGCTGCTAATGCCGTTGACTTGTTCAATTTTGAATG GGATACTCGGTGGGATAGGGGTGTACATTGCTTTGAACATGTATGAGTATGTAGTGATGTTAGTGAAGTGGATTGTTGAGATGAGGAGAGTGGTGGTGGA TGAACATAATCAGGTATCAGCTACTGCTACTGCTCTCGAGGATCCTAGTACCGGAGAAGCGAACCGTGTTTAG
AA sequence Show only first row Show all	>Lus10034287 pacid=23176050 polypeptide=Lus10034287 locus=Lus10034287.g ID=Lus10034287.BGIv1.0 annot-version=v1.0 MKVVKDIDWGGLKEGVPAFFTMLLMPLTCSILNGILGGIGVYIALNMYEYVVMLVKWIVEMRRVVVDEHNQVSATATALEDPSTGEANRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50300		ATAZG2	ARABIDOPSIS THALIANA AZA-GUANI...		Lus10034287 [exp]	0	1
AT5G48540			receptor-like protein kinase-r...		Lus10035754 [exp]	1.0	0.8336
					Lus10022997 [exp]	6.3	0.7982
AT5G44440			FAD-binding Berberine family p...		Lus10010643 [exp]	8.2	0.8258
AT4G13230			Late embryogenesis abundant pr...		Lus10011889 [exp]	10.8	0.8136
					Lus10020451 [exp]	12.8	0.8080
AT2G20030			RING/U-box superfamily protein...		Lus10000885 [exp]	13.5	0.7842
					Lus10041373 [exp]	13.9	0.7775
AT4G01310			Ribosomal L5P family protein (...		Lus10036391 [exp]	15.9	0.7928
AT2G25180	GARP	ARR12	response regulator 12 (.1)		Lus10036303 [exp]	18.3	0.7388
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	21.0	0.7706

Compare expression of checked genes

Lus10034287 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.