Lus10034328 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010258 102 / 3e-29 ND /
Lus10001094 97 / 1e-26 ND /
Lus10034037 81 / 2e-20 ND /
Lus10018800 57 / 7e-11 ND /
Lus10012084 56 / 2e-10 ND /
Lus10019357 52 / 3e-08 ND /
Lus10013669 42 / 1e-05 ND /
Lus10012424 37 / 0.0006 ND /
Lus10038590 38 / 0.001 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034328 pacid=23175945 polypeptide=Lus10034328 locus=Lus10034328.g ID=Lus10034328.BGIv1.0 annot-version=v1.0
ATGCCGAGGTTATATTCCTTAACAGAGTTCTACACCTTCGGCAGGTCTCACCTCACAAAGTGCGTGCACAAGCCCTCGCTGCAGCCCATCGCGAGACAGA
AACTCAACACTCTCGATTTTTCTTCTTATAGCCTCTGTCTCCACTTAACACTTCCATTCTTTTCCTCTCACCGAAGAGGCATCTCCGACCAGCGGTCGCC
GGCGTTCGTCCGTCCGTCGGCTCCGACCCCATCACCCCCTTTACCAGCGAGCCAATCTCCGATTCAAGATGTGATAGGTGGTTCTGCTGGTGGCAAGGAC
GGTGATGAAAATTGCCGTCCTAATAAAGCGAAGAAAGAATGGTATAATCTGCATATGGTCGATTATACTAAGACTAACATGTGGATAGAGAAGGTAAAGG
TAAGAGATTGGTCTAATGTAGCTGAGATTAACTGTTTCATTAAGGTGGGTTTGCATAAAGATATTGGTGTTCTTGAAAAATAA
AA sequence
>Lus10034328 pacid=23175945 polypeptide=Lus10034328 locus=Lus10034328.g ID=Lus10034328.BGIv1.0 annot-version=v1.0
MPRLYSLTEFYTFGRSHLTKCVHKPSLQPIARQKLNTLDFSSYSLCLHLTLPFFSSHRRGISDQRSPAFVRPSAPTPSPPLPASQSPIQDVIGGSAGGKD
GDENCRPNKAKKEWYNLHMVDYTKTNMWIEKVKVRDWSNVAEINCFIKVGLHKDIGVLEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034328 0 1
Lus10003536 8.5 0.9975
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10032872 10.9 0.8518
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025763 12.0 0.9975
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10009617 13.0 0.9348
AT3G05610 Plant invertase/pectin methyle... Lus10031469 13.1 0.9348
Lus10011078 14.7 0.9975
AT5G45040 CYTC6A cytochrome c6A, Cytochrome c (... Lus10038346 15.7 0.8410
AT5G42870 ATPAH2 phosphatidic acid phosphohydro... Lus10021733 17.0 0.9975
AT5G54010 UDP-Glycosyltransferase superf... Lus10039237 19.0 0.9975
AT5G19580 glyoxal oxidase-related protei... Lus10012979 20.2 0.7997

Lus10034328 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.