Lus10034330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G25420 190 / 5e-58 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT1G34220 174 / 2e-49 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G35730 139 / 2e-37 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT2G19710 111 / 7e-27 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 96 / 2e-21 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 58 / 2e-09 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT2G14830 54 / 5e-08 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 52 / 2e-07 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G51900 44 / 9e-05 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041442 361 / 1e-125 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10006061 172 / 1e-49 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028724 172 / 2e-49 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10040542 105 / 9e-25 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041836 96 / 1e-21 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028383 92 / 2e-20 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10000978 91 / 9e-20 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041468 74 / 1e-14 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 71 / 2e-13 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G121300 228 / 3e-73 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.013G117100 164 / 9e-46 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.019G087400 160 / 9e-45 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 154 / 7e-43 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.006G149800 135 / 4e-35 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.010G124100 75 / 2e-16 AT1G25420 71 / 2e-15 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.017G113900 74 / 8e-15 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 65 / 2e-11 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G038600 65 / 2e-11 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.010G127000 64 / 4e-11 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10034330 pacid=23175961 polypeptide=Lus10034330 locus=Lus10034330.g ID=Lus10034330.BGIv1.0 annot-version=v1.0
ATGCGTAAGGAGATAGCACAGTTCTTGCAAGCTGGCCAAGAAGCAATTGCTCGTATTCGTGTGGAACATGTAATACGGGAACAAAATTTATGGGCTGCTT
TTGAGATACTGGAGCTTTTCTGCGAGTTTGTCCTTGCTCGAATTCCAATTCTTGATGCTCAGAATCAGTTTGATTTATCGATTCCTTTGAGCTACATCTC
AGCTGCTGTGAAGAATGCTGGAGGCATTCAGAAATGGGAGTGCTCCATATGCCACTCAAACTCTTCTTCTATTTTATGTAACTATTTTCCATCTACATCT
TCAGAGAATGTCCTGCCGAAGTACGGGAGGCTGTTGCGACGGTTGGCTGTTGCGAGGAGAATATTTTCCTCTCCGGGATGGTCAGAAGGTCCAGATCTAC
TACATATTCAGAACTTATTTACTGCTAAATATGGAAAAGAGTTCGTTATGGCTGCTTCAGAACTTCGTCCCGATTCTGGTGTCAACCGTGCAATAATTGA
AAAACTAGCAGTTGGTGCTCCTGCGCCAGAAGAAAGACTCAAGGTGTTGAAGGAAATTGCCAGAGAGTACAATTTGGAATGGGATTCTTCTGAAACAGAA
GCTGAGCTAAATAAAAGACATGAGGATCTTCTGGCTGGATCGAAGCAGGCAGTAGTCGAGGGATCCCAATCTCAAGTTCCCACTATCCAGACTTCTCCCA
GTCCCAGCTCTACAATGAATGGAGCATCATCCGTTAATAGCGGACGAGAAGAACAAAATGTGCGGCCCCCAGTCAAGACTGATGAAATCGTCCCACCGTC
GATCAAAAGTCACAATCCGGATCCAATCACCCTGAGTAGACAGGACAGGAATCCACAATCGTCTGATGTTCTGGAGGTAGCTCGAGCTGCTATCGCCACA
GCGGAGAGAGCTACTGCAGCAGCCCGTGCTGCCGCTGCCCTTGTGAGCGTTAATTTGAGTTCTCAGAAGCTTCAATGA
AA sequence
>Lus10034330 pacid=23175961 polypeptide=Lus10034330 locus=Lus10034330.g ID=Lus10034330.BGIv1.0 annot-version=v1.0
MRKEIAQFLQAGQEAIARIRVEHVIREQNLWAAFEILELFCEFVLARIPILDAQNQFDLSIPLSYISAAVKNAGGIQKWECSICHSNSSSILCNYFPSTS
SENVLPKYGRLLRRLAVARRIFSSPGWSEGPDLLHIQNLFTAKYGKEFVMAASELRPDSGVNRAIIEKLAVGAPAPEERLKVLKEIAREYNLEWDSSETE
AELNKRHEDLLAGSKQAVVEGSQSQVPTIQTSPSPSSTMNGASSVNSGREEQNVRPPVKTDEIVPPSIKSHNPDPITLSRQDRNPQSSDVLEVARAAIAT
AERATAAARAAAALVSVNLSSQKLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G25420 Regulator of Vps4 activity in ... Lus10034330 0 1
AT4G33950 ATOST1, P44, SR... SNF1-RELATED PROTEIN KINASE 2.... Lus10012050 10.0 0.9039
AT3G03610 ELMO/CED-12 family protein (.1... Lus10009523 18.3 0.8907
AT3G54480 SKP5, SKIP5 SKP1/ASK-interacting protein 5... Lus10024168 26.2 0.8847
AT5G13240 transcription regulators (.1) Lus10013491 33.5 0.8634
AT2G20120 COV1 CONTINUOUS VASCULAR RING, Prot... Lus10011099 34.6 0.8790
AT3G22260 Cysteine proteinases superfami... Lus10010459 37.5 0.8555
AT4G36400 D2HGDH D-2-hydroxyglutarate dehydroge... Lus10028342 48.7 0.8635
AT3G01040 GAUT13 galacturonosyltransferase 13 (... Lus10015379 52.2 0.8686
AT2G26070 RTE1 REVERSION-TO-ETHYLENE SENSITIV... Lus10030001 58.0 0.8683
AT1G15030 Protein of unknown function (D... Lus10031598 60.7 0.8534

Lus10034330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.