Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 120 / 6e-35 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 111 / 2e-31 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 108 / 2e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 108 / 3e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 102 / 3e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G25930 88 / 1e-22 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 85 / 3e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 84 / 1e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 70 / 5e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041436 [exp] 293 / 2e-103 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 117 / 6e-33 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 120 / 6e-32 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10006701 [exp] 108 / 1e-30 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 107 / 3e-30 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 104 / 1e-28 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 90 / 7e-23 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10032142 [exp] 82 / 4e-20 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10014545 [exp] 81 / 9e-20 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G123200 [exp] 221 / 6e-75 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 214 / 3e-72 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 165 / 8e-53 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121800 [exp] 149 / 2e-46 AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G112300 [exp] 132 / 8e-40 AT1G68300 113 / 3e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 125 / 1e-36 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 120 / 5e-35 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123300 [exp] 120 / 5e-35 AT3G25930 104 / 5e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 117 / 1e-33 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G193800 [exp] 115 / 3e-33 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10034337 pacid=23175925 polypeptide=Lus10034337 locus=Lus10034337.g ID=Lus10034337.BGIv1.0 annot-version=v1.0 ATGGAGAAGGAGAAGAAGGTGATGGTTGCAATAGACGAGAGCGAGTTCAGCCACTACGCCCTTCAATGGGCTCTTTCCAGTTTGGGAGACACCATTTCCA AATCCTCCCCACTGCTCCTCTTCACCGTTCAGCCCCTCTCCGACTTCAATTATCTCCACGCTTCCACTTTCGGCGCTGCTCCTCCGGAATTGTTGGCGTC CGTACAGGAGAATCACAACAAGCTTACAACGGCTCTGTTGGAGAAAGCTAAACAGATTTGTGTTGCCCATGGGGTTGAAGCAGAAACTGAGACTGGAGTT GGGGATCCTAAAGAAGCCATATGTGAGGCGGTGGATAAACACGGCATCCAGTTGCTGGTTTTGGGAAGTCATAGCCGAGGACCTATTCAGAGGGCGTTCC TGGGAAGTGTTAGCAACTACTGCGTTCACAATGCAAAATGCCCTGTTCTTGTTGTCAAGAAACCAGCAGCTTAG
AA sequence Show only first row Show all	>Lus10034337 pacid=23175925 polypeptide=Lus10034337 locus=Lus10034337.g ID=Lus10034337.BGIv1.0 annot-version=v1.0 MEKEKKVMVAIDESEFSHYALQWALSSLGDTISKSSPLLLFTVQPLSDFNYLHASTFGAAPPELLASVQENHNKLTTALLEKAKQICVAHGVEAETETGV GDPKEAICEAVDKHGIQLLVLGSHSRGPIQRAFLGSVSNYCVHNAKCPVLVVKKPAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68300			Adenine nucleotide alpha hydro...		Lus10034337 [exp]	0	1
AT1G17370		UBP1B	oligouridylate binding protein...		Lus10011924 [exp]	2.4	0.9255
AT4G17900			PLATZ transcription factor fam...		Lus10030968 [exp]	4.0	0.9346
AT1G48300			unknown protein		Lus10038034 [exp]	4.1	0.9396
AT5G46180		DELTA-OAT	ornithine-delta-aminotransfera...		Lus10023299 [exp]	6.0	0.9274
AT3G61610			Galactose mutarotase-like supe...		Lus10005147 [exp]	7.1	0.9168
AT1G57790			F-box family protein (.1)		Lus10022706 [exp]	7.5	0.8986
AT1G03290			unknown protein		Lus10028005 [exp]	9.2	0.9205
AT3G61610			Galactose mutarotase-like supe...		Lus10003035 [exp]	9.6	0.9129
AT5G62020	HSF	AT-HSFB2A	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10014994 [exp]	9.8	0.9016
AT1G51550			Kelch repeat-containing F-box ...		Lus10034827 [exp]	10.0	0.9007

Compare expression of checked genes

Lus10034337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.