Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17190 247 / 4e-86 unknown protein AT3G03160 245 / 1e-85 unknown protein AT1G48440 103 / 2e-29 B-cell receptor-associated 31-like (.1) AT3G17780 91 / 2e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005110 [exp] 263 / 1e-92 AT5G17190 244 / 6e-85 unknown protein Lus10031957 [exp] 165 / 1e-53 AT5G17190 159 / 3e-51 unknown protein Lus10040126 [exp] 91 / 3e-24 AT1G48440 191 / 3e-64 B-cell receptor-associated 31-like (.1) Lus10001080 [exp] 91 / 4e-24 AT1G48440 190 / 7e-64 B-cell receptor-associated 31-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G133600 [exp] 248 / 2e-86 AT5G17190 244 / 7e-85 unknown protein Potri.010G108000 [exp] 243 / 1e-84 AT5G17190 245 / 1e-85 unknown protein Potri.015G035400 [exp] 157 / 1e-50 AT3G03160 142 / 1e-44 unknown protein Potri.012G042700 [exp] 108 / 2e-31 AT1G48440 172 / 2e-56 B-cell receptor-associated 31-like (.1) Potri.015G030801 [exp] 100 / 8e-28 AT1G48440 184 / 4e-61 B-cell receptor-associated 31-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05529 [flax] [poplar] Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10034347 pacid=23175939 polypeptide=Lus10034347 locus=Lus10034347.g ID=Lus10034347.BGIv1.0 annot-version=v1.0 ATGGCACTCGAGTGGGTGGTGCTTGGATACGCGGCAGCGGCGGAGGCGATCATGGTCCTCCTCCTGACAATCCCGGGCCTCGACGGACTGCGCAAGGGAC TGATCGCCGTCACGCGCAACCTTCTGAAGCCCTTCTTGTCGGTAGTTCCGTTTTGCCTTTTCCTGTTCATGGATATCTACTGGAAGTACGAGACGCGGCC GAGTTGTGAGGGCGATTCCTGCAGCCCTAGCGAGCAGCTCCGTCACCAGAAGTCCATAATGAAGAGCCAGAGGAACGCATTGTTGATTGCGGCAGCGCTC GTCTTCTATTGGCTGCTTTACTCCGTCACCAATCTGGTCGTCAAGATCGAGCAGCTCAATGTGCGCATTGAGAGGCTCAAGAGCAAGGACTGA
AA sequence Show only first row Show all	>Lus10034347 pacid=23175939 polypeptide=Lus10034347 locus=Lus10034347.g ID=Lus10034347.BGIv1.0 annot-version=v1.0 MALEWVVLGYAAAAEAIMVLLLTIPGLDGLRKGLIAVTRNLLKPFLSVVPFCLFLFMDIYWKYETRPSCEGDSCSPSEQLRHQKSIMKSQRNALLIAAAL VFYWLLYSVTNLVVKIEQLNVRIERLKSKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17190			unknown protein		Lus10034347 [exp]	0	1
AT2G45960		PIP1;2, ATHH2, ...	TRANSMEMBRANE PROTEIN A, NAMED...		Lus10035483 [exp]	2.4	0.8176
AT2G01650		PUX2	plant UBX domain-containing pr...		Lus10034612 [exp]	4.2	0.7956
AT1G12310			Calcium-binding EF-hand family...		Lus10032205 [exp]	4.6	0.7619
AT3G16240		DELTA-TIP1, ATT...	delta tonoplast integral prote...		Lus10038293 [exp]	4.6	0.7817
AT4G38500			Protein of unknown function (D...		Lus10025082 [exp]	9.9	0.7411
AT4G14010		RALFL32	ralf-like 32 (.1)		Lus10023223 [exp]	11.7	0.7783
AT1G53750		RPT1A	regulatory particle triple-A 1...		Lus10031815 [exp]	12.0	0.7548
AT5G65670	AUX_IAA	IAA9	indole-3-acetic acid inducible...		Lus10011583 [exp]	16.5	0.7316
AT5G35330		MBD2, MBD02, AT...	METHYL-CPG-BINDING DOMAIN PROT...		Lus10021593 [exp]	16.7	0.7301
AT1G78300		14-3-3OMEGA, GF...	14-3-3 PROTEIN G-BOX FACTOR14 ...		Lus10010349 [exp]	19.4	0.7289

Compare expression of checked genes

Lus10034347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.