Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005100 [exp] 0 / 1 AT4G20330 315 / 2e-108 Transcription initiation factor TFIIE, beta subunit (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034352 pacid=23176022 polypeptide=Lus10034352 locus=Lus10034352.g ID=Lus10034352.BGIv1.0 annot-version=v1.0 ATGGCACTTCAAGGGCAACTTGATAAATTCAAGAAGCAGCAAAAAAAGATGCATTCAATGATCAGCAGCATTGCACCGAAAGCAGGACCTTCTAAATCAT TTCCAGCTTCAAAATCTGCCAAGGCTCCGGTTCCTGCAGTCAAGTTTTCAAATGATCAGAGAGGCTTCAGCATGTCCACAACATTCGGAAGGCTCCCGTG GGATCACAGATGA
AA sequence Show only first row Show all	>Lus10034352 pacid=23176022 polypeptide=Lus10034352 locus=Lus10034352.g ID=Lus10034352.BGIv1.0 annot-version=v1.0 MALQGQLDKFKKQQKKMHSMISSIAPKAGPSKSFPASKSAKAPVPAVKFSNDQRGFSMSTTFGRLPWDHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034352 [exp]	0	1
					Lus10018837 [exp]	1.4	0.9886
					Lus10039496 [exp]	3.5	0.9830
AT4G10790			UBX domain-containing protein ...		Lus10039951 [exp]	3.5	0.9635
					Lus10009927 [exp]	3.5	0.9779
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	4.2	0.9426
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10030134 [exp]	6.2	0.9417
AT4G36470			S-adenosyl-L-methionine-depend...		Lus10028330 [exp]	6.3	0.9632
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	6.3	0.9645
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032621 [exp]	6.5	0.9527
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	6.6	0.9673

Compare expression of checked genes

Lus10034352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.