Lus10034357 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67090 180 / 3e-58 RBCS1A ribulose bisphosphate carboxylase small chain 1A (.1.2)
AT5G38430 179 / 1e-57 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
AT5G38420 179 / 2e-57 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
AT5G38410 179 / 2e-57 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005093 311 / 8e-110 AT5G38420 186 / 3e-60 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10028471 190 / 7e-62 AT5G38420 265 / 1e-91 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10009172 189 / 1e-61 AT5G38420 264 / 2e-91 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10017597 189 / 2e-61 AT5G38410 271 / 2e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Lus10033558 189 / 2e-61 AT5G38410 272 / 1e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G091401 228 / 3e-77 AT5G38410 183 / 1e-59 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Potri.004G100000 174 / 7e-56 AT1G67090 286 / 3e-100 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.017G114600 171 / 1e-54 AT1G67090 292 / 2e-102 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.006G167901 0 / 1 AT5G38410 0 / 1 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00101 RuBisCO_small Ribulose bisphosphate carboxylase, small chain
Representative CDS sequence
>Lus10034357 pacid=23175908 polypeptide=Lus10034357 locus=Lus10034357.g ID=Lus10034357.BGIv1.0 annot-version=v1.0
ATGTCCGGAATGTCCTTGCCCGTGGCAGCTGGTTACTACTATGGCTTGAAATCCAACTCGTCCTCATCGTCATTAATGCCGGTCTTCAACAGTACCACCA
CCATAGCTGCTGAATCTGATGTTGCATGGCGGAGGAGGGCTTTGTCAAACAATAATAATGGGTCGAGGACGAGGATCCATTGTTGCATGCAGACATGGAA
TCCAATCAGCAACAAGAAGTTCGAGACTCTGTCCTACCTGCCTCCTCTGTCCCAGGAATCCATCGCCAGGGAGATTGATTACATGCTCAGCAAGGGTTGG
ATTCCTTGCCTTGAATTTGACCAGGTGGGGTATGTGTACAGGGAGAACAGCAAGATGCCGGGGTACTACGACGGGAGGTACTGGACACTGTGGAAGTTGC
CAATGTTCGGATGTAATGACTCATCACAAGTGTTGAAGGAGATCCAACTCTGCAAGCAAACTTACCCTAACGCCTACATAAGGTGCCTGGCTTTCGACAA
CAAGCAGCAGGTTCAGTGCATGGCTTTCCTCATCCAAACCCCTTCTTCCTCCGATGCTTGA
AA sequence
>Lus10034357 pacid=23175908 polypeptide=Lus10034357 locus=Lus10034357.g ID=Lus10034357.BGIv1.0 annot-version=v1.0
MSGMSLPVAAGYYYGLKSNSSSSSLMPVFNSTTTIAAESDVAWRRRALSNNNNGSRTRIHCCMQTWNPISNKKFETLSYLPPLSQESIAREIDYMLSKGW
IPCLEFDQVGYVYRENSKMPGYYDGRYWTLWKLPMFGCNDSSQVLKEIQLCKQTYPNAYIRCLAFDNKQQVQCMAFLIQTPSSSDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67090 RBCS1A ribulose bisphosphate carboxyl... Lus10034357 0 1
AT5G03310 SAUR-like auxin-responsive pro... Lus10037990 3.7 0.8234
AT3G50610 unknown protein Lus10009346 5.3 0.8311
AT1G08090 LIN1, ACH1, NRT... LATERAL ROOT INITIATION 1, nit... Lus10016120 19.4 0.7435
AT1G62975 bHLH bHLH125 basic helix-loop-helix (bHLH) ... Lus10006707 29.0 0.7264
AT4G02160 unknown protein Lus10010018 43.2 0.7129
AT1G63740 Disease resistance protein (TI... Lus10010546 51.2 0.6937
AT5G46490 Disease resistance protein (TI... Lus10042465 51.7 0.7292
AT4G35160 O-methyltransferase family pro... Lus10018628 52.2 0.7223
AT5G45820 PKS18, CIPK20, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10007283 83.4 0.6944
Lus10017936 138.0 0.6797

Lus10034357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.