Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13710 150 / 5e-46 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT1G55190 147 / 5e-45 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13720 145 / 4e-44 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G08770 108 / 2e-29 PRA1.E prenylated RAB acceptor 1.E (.1) AT1G17700 107 / 2e-29 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT2G38360 94 / 1e-23 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT3G56110 92 / 4e-23 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT5G01640 92 / 9e-23 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT1G04260 89 / 4e-22 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT5G05380 81 / 6e-19 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005088 [exp] 251 / 9e-86 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10015631 [exp] 213 / 2e-70 AT1G55190 193 / 7e-63 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10037649 [exp] 188 / 4e-61 AT1G55190 153 / 2e-47 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10014747 [exp] 99 / 1e-25 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 97 / 5e-25 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 95 / 4e-24 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10026404 [exp] 92 / 9e-23 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 92 / 2e-22 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10042535 [exp] 88 / 1e-21 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G035200 [exp] 154 / 2e-47 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 127 / 2e-36 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.005G219100 [exp] 112 / 7e-31 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 102 / 3e-27 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G044000 [exp] 98 / 1e-25 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.006G104400 [exp] 81 / 8e-19 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.016G126400 [exp] 81 / 1e-18 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.010G183300 [exp] 79 / 3e-18 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.019G124100 [exp] 74 / 2e-16 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.001G472300 [exp] 71 / 5e-15 AT5G56230 115 / 4e-32 prenylated RAB acceptor 1.G2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [flax] [poplar] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Lus10034363 pacid=23176029 polypeptide=Lus10034363 locus=Lus10034363.g ID=Lus10034363.BGIv1.0 annot-version=v1.0 ATGACCAACTACGGAACAATCCCAATATCCTCCTCCGCCTCCGCTGGTGCGTCTCCTTCCGAAGTCGGCGGATCCTCACCCTACTCGAACCTCGCCTACA TCTCCCGCGCCAAGGATCGCATCAAAGACGGCCTAGGCACGATGCGGCCTTGGAAATTGATGTTGGAGCTACACAGCATAGGGCTCCCGGAAAACCTAGC CGATGCTCTCAGCCGCCTCAAGACCAATTCGGCCTACTTCCGGATGAACTACGCCATAATCGTTCTGGGGATCTTGTTCCTCAGCCTGCTCTGGCACCCG ATCTCGTTGATTGTGTTCATCGCCGCCATGGCGGGGTGGCTGTTCCTCTATTTCCTCAGGGATGAACCCCTGGTTGTGTTCGGGAAGCTGATCGACGACA GCGCTGTACTCAGCTCGCTGTCGGTCGTGACGGCGGTTCTATTGTTTCTGACGGATGCTTTCTGGCATATATTGGGGTCCCTATTGGTGGGAGTAGCGGT GGTGGTGATTCACGGAGTTGCGAGAAGGACGGATGACTTATTTTTGGATGAGGATTCAACCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCTTGT TAA
AA sequence Show only first row Show all	>Lus10034363 pacid=23176029 polypeptide=Lus10034363 locus=Lus10034363.g ID=Lus10034363.BGIv1.0 annot-version=v1.0 MTNYGTIPISSSASAGASPSEVGGSSPYSNLAYISRAKDRIKDGLGTMRPWKLMLELHSIGLPENLADALSRLKTNSAYFRMNYAIIVLGILFLSLLWHP ISLIVFIAAMAGWLFLYFLRDEPLVVFGKLIDDSAVLSSLSVVTAVLLFLTDAFWHILGSLLVGVAVVVIHGVARRTDDLFLDEDSTXXXXXXXXXXXSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10034363 [exp]	0	1
AT2G27260			Late embryogenesis abundant (L...		Lus10005216 [exp]	2.0	0.9127
AT1G47750		PEX11A	peroxin 11A (.1)		Lus10029260 [exp]	3.2	0.9011
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10020077 [exp]	4.9	0.8895
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10000196 [exp]	5.5	0.8723
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10008893 [exp]	5.5	0.8941
AT5G67300	MYB	ATMYB44, AtMYBr...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10010260 [exp]	5.9	0.8899
AT4G29120			6-phosphogluconate dehydrogena...		Lus10012950 [exp]	6.3	0.8761
AT5G17850			Sodium/calcium exchanger famil...		Lus10020318 [exp]	8.7	0.8907
AT1G13250		GATL3	galacturonosyltransferase-like...		Lus10041489 [exp]	8.9	0.8693
AT1G14720		ATXTH28, EXGT-A...	xyloglucan endotransglycosylas...		Lus10029000 [exp]	10.5	0.8757

Compare expression of checked genes

Lus10034363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.