Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09610 110 / 2e-31 Protein of unknown function (DUF579) (.1) AT1G33800 107 / 3e-30 Protein of unknown function (DUF579) (.1) AT4G09990 105 / 1e-29 Protein of unknown function (DUF579) (.1) AT1G71690 99 / 7e-27 Protein of unknown function (DUF579) (.1) AT1G67330 75 / 9e-18 Protein of unknown function (DUF579) (.1) AT1G27930 72 / 6e-17 Protein of unknown function (DUF579) (.1) AT2G15440 56 / 7e-11 Protein of unknown function (DUF579) (.1) AT4G24910 54 / 2e-10 Protein of unknown function (DUF579) (.1) AT3G50220 49 / 3e-08 IRX15 IRREGULAR XYLEM 15, Protein of unknown function (DUF579) (.1) AT5G67210 47 / 8e-08 IRX15-L IRX15-LIKE, Protein of unknown function (DUF579) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005829 [exp] 128 / 4e-38 AT4G09990 360 / 8e-126 Protein of unknown function (DUF579) (.1) Lus10005822 [exp] 127 / 6e-38 AT4G09990 360 / 6e-126 Protein of unknown function (DUF579) (.1) Lus10002954 [exp] 102 / 4e-28 AT4G09990 298 / 1e-101 Protein of unknown function (DUF579) (.1) Lus10006415 [exp] 75 / 8e-18 AT1G67330 368 / 1e-128 Protein of unknown function (DUF579) (.1) Lus10011360 [exp] 75 / 1e-17 AT1G67330 350 / 1e-121 Protein of unknown function (DUF579) (.1) Lus10037026 [exp] 72 / 1e-16 AT1G67330 382 / 1e-134 Protein of unknown function (DUF579) (.1) Lus10012537 [exp] 72 / 1e-16 AT1G27930 313 / 2e-107 Protein of unknown function (DUF579) (.1) Lus10003160 [exp] 71 / 2e-16 AT4G24910 236 / 3e-76 Protein of unknown function (DUF579) (.1) Lus10015780 [exp] 71 / 2e-16 AT1G67330 381 / 4e-134 Protein of unknown function (DUF579) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G102200 [exp] 124 / 1e-36 AT1G33800 362 / 3e-126 Protein of unknown function (DUF579) (.1) Potri.019G076300 [exp] 121 / 2e-35 AT1G09610 367 / 2e-128 Protein of unknown function (DUF579) (.1) Potri.004G226800 [exp] 110 / 2e-31 AT1G09610 424 / 4e-151 Protein of unknown function (DUF579) (.1) Potri.003G003801 [exp] 107 / 5e-30 AT1G09610 429 / 5e-153 Protein of unknown function (DUF579) (.1) Potri.001G056300 [exp] 72 / 9e-17 AT1G67330 366 / 4e-128 Protein of unknown function (DUF579) (.1) Potri.015G096900 [exp] 70 / 7e-16 AT4G24910 248 / 6e-81 Protein of unknown function (DUF579) (.1) Potri.003G172300 [exp] 69 / 9e-16 AT1G67330 369 / 1e-129 Protein of unknown function (DUF579) (.1) Potri.009G098800 [exp] 63 / 2e-13 AT5G67210 293 / 2e-98 IRX15-LIKE, Protein of unknown function (DUF579) (.1) Potri.001G302600 [exp] 55 / 2e-10 AT5G67210 305 / 2e-103 IRX15-LIKE, Protein of unknown function (DUF579) (.1) Potri.007G047000 [exp] 54 / 4e-10 AT5G67210 399 / 2e-140 IRX15-LIKE, Protein of unknown function (DUF579) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04669 [flax] [poplar] Polysacc_synt_4 Polysaccharide biosynthesis
Representative CDS sequence Show only first row Show all	>Lus10034373 pacid=23176016 polypeptide=Lus10034373 locus=Lus10034373.g ID=Lus10034373.BGIv1.0 annot-version=v1.0 ATGGTGAACACTCCCACCGGATACCACGACGAGGCTCCCGGGAGGATGCCGGCGATATACACCGCTGGGTTGATGGCGAGGAATAAGGAAGCAGAGGAGA CGGAAGTGTCTGTTCACGATGTGGATAGGACGGTGGAGGACAGATTTTCTAAGGCATTTCTGTGCGAAGGTTACTTAACGGAGCAAGAGGGTAGGCTAAG GTGTTTCTGTGAGAAGGTTACTTGA
AA sequence Show only first row Show all	>Lus10034373 pacid=23176016 polypeptide=Lus10034373 locus=Lus10034373.g ID=Lus10034373.BGIv1.0 annot-version=v1.0 MVNTPTGYHDEAPGRMPAIYTAGLMARNKEAEETEVSVHDVDRTVEDRFSKAFLCEGYLTEQEGRLRCFCEKVT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33800			Protein of unknown function (D...		Lus10034373 [exp]	0	1
					Lus10018742 [exp]	1.0	0.9845
AT1G76250			unknown protein		Lus10012274 [exp]	4.2	0.9683
AT5G04010			F-box family protein (.1)		Lus10035421 [exp]	6.5	0.9577
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10015737 [exp]	7.1	0.9603
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Lus10041247 [exp]	7.1	0.9642
AT2G28500	AS2	LBD11	LOB domain-containing protein ...		Lus10040373 [exp]	7.5	0.9309
AT3G59530		LAP3	LESS ADHERENT POLLEN 3, Calciu...		Lus10019377 [exp]	7.7	0.9493
AT1G70500			Pectin lyase-like superfamily ...		Lus10030888 [exp]	9.6	0.9614
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10021267 [exp]	10.4	0.9537
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10003468 [exp]	11.0	0.9462

Compare expression of checked genes

Lus10034373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.