Lus10034378 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 261 / 3e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 260 / 6e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 245 / 5e-85 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012599 301 / 5e-107 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10035133 291 / 8e-103 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10031970 291 / 8e-103 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10038012 288 / 7e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10009252 288 / 7e-102 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 277 / 2e-97 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 271 / 4e-95 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 270 / 1e-94 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10034378 pacid=23175934 polypeptide=Lus10034378 locus=Lus10034378.g ID=Lus10034378.BGIv1.0 annot-version=v1.0
ATGGCGACGGCAGCAGCTGCCTCCCCGATCGAGTCCGTCCAGTGCTTCGGCCGCAAGAAGACCGCGGTCGCCGTCACTCACTGTAAGCGAGGAAGGGGAC
TCATCAAGCTCAATGGCACCCCAATCGAGCTCGTGGAGCCCGAGATCCTCCGTTTCAAGGCCGTCGAACCCATCCTCCTCCTAGGCCGCCACCGTTTCAG
CGGCGTCGACATGCGCATCCGAGTCAAAGGAGGCGGACACACCTCCCAGATCTACGCCATCCGTCAGAGCATCGCCAAGGCACTCGTCGCTTTCTACCAG
AAGTTCGTCGACGAGCAGAGCAAGAAGGAGATCAAGGACCTCTTGGTCAGCTACGACAGGACTTTGCTCGTCGCCGATCCCAGACGTTGCGAGCCTAAGA
AGTTCGGTGGCCGCGGTGCTCGTTCCAGATTCCAGAAGAGTTACCGTTGA
AA sequence
>Lus10034378 pacid=23175934 polypeptide=Lus10034378 locus=Lus10034378.g ID=Lus10034378.BGIv1.0 annot-version=v1.0
MATAAAASPIESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELVEPEILRFKAVEPILLLGRHRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQ
KFVDEQSKKEIKDLLVSYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18380 Ribosomal protein S5 domain 2-... Lus10034378 0 1
AT2G20585 NFD6 nuclear fusion defective 6 (.1... Lus10039888 2.2 0.9229
AT2G40510 Ribosomal protein S26e family ... Lus10029042 4.1 0.9132
AT5G60670 Ribosomal protein L11 family p... Lus10041308 4.2 0.9393
AT5G44500 Small nuclear ribonucleoprotei... Lus10023386 4.6 0.9311
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10037445 4.8 0.9473
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032962 9.5 0.9225
AT4G29830 VIP3 vernalization independence 3, ... Lus10021571 10.5 0.9114
AT1G75330 OTC ornithine carbamoyltransferase... Lus10033203 10.5 0.9192
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10023438 13.1 0.8904
AT3G49470 NACA2 nascent polypeptide-associated... Lus10015579 13.5 0.9152

Lus10034378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.