Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45490 60 / 3e-11 ATAUR3 ataurora3 (.1) AT2G25880 51 / 7e-08 ATAUR2 ataurora2 (.1.2) AT4G32830 50 / 8e-08 ATAUR1 ataurora1 (.1) AT1G20930 48 / 7e-07 CDKB2;2 cyclin-dependent kinase B2;2 (.1) AT1G76540 48 / 7e-07 CDKB2;1 cyclin-dependent kinase B2;1 (.1) AT2G26980 47 / 2e-06 CIPK3, SnRK3.17 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) AT1G29230 46 / 3e-06 ATCIPK18, ATWL1, CIPK18, SnRK3.20 SNF1-RELATED PROTEIN KINASE 3.20, WPL4-LIKE 1, CBL-interacting protein kinase 18 (.1) AT2G30360 45 / 8e-06 PKS5, CIPK11, SnRK3.22, SIP4 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1) AT1G01140 44 / 2e-05 PKS6, CIPK9, SnRK3.12 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) AT5G21222 44 / 3e-05 protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020580 [exp] 72 / 3e-15 AT2G45490 482 / 3e-174 ataurora3 (.1) Lus10006266 [exp] 72 / 3e-15 AT2G45490 427 / 1e-152 ataurora3 (.1) Lus10011951 [exp] 62 / 2e-12 AT4G19540 111 / 3e-30 IND1(iron-sulfur protein required for NADH dehydrogenase)-like (.1) Lus10019468 [exp] 58 / 6e-11 AT4G19540 117 / 2e-32 IND1(iron-sulfur protein required for NADH dehydrogenase)-like (.1) Lus10005487 [exp] 50 / 1e-07 AT4G32830 545 / 0.0 ataurora1 (.1) Lus10006033 [exp] 50 / 2e-07 AT4G32830 488 / 2e-175 ataurora1 (.1) Lus10022590 [exp] 46 / 4e-06 AT2G26980 684 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Lus10021488 [exp] 46 / 5e-06 AT2G26980 591 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Lus10029232 [exp] 45 / 6e-06 AT4G18700 466 / 3e-165 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G080500 [exp] 58 / 2e-10 AT2G45490 470 / 2e-169 ataurora3 (.1) Potri.006G235000 [exp] 50 / 8e-08 AT4G32830 553 / 0.0 ataurora1 (.1) Potri.005G257500 [exp] 49 / 2e-07 AT1G76540 552 / 0.0 cyclin-dependent kinase B2;1 (.1) Potri.018G057700 [exp] 48 / 7e-07 AT4G32830 544 / 0.0 ataurora1 (.1) Potri.002G003400 [exp] 47 / 2e-06 AT1G76540 553 / 0.0 cyclin-dependent kinase B2;1 (.1) Potri.016G133900 [exp] 47 / 2e-06 AT5G01820 490 / 2e-172 SNF1-RELATED PROTEIN KINASE 3.15, SOS2-like protein kinase 24, CBL-INTERACTING PROTEIN KINASE 14, serine/threonine protein kinase 1 (.1) Potri.001G222600 [exp] 46 / 3e-06 AT2G26980 752 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Potri.018G130500 [exp] 46 / 4e-06 AT5G35410 711 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Potri.019G127500 [exp] 46 / 4e-06 AT5G58380 641 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.014G104200 [exp] 45 / 6e-06 AT1G01140 688 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10034380 pacid=23175933 polypeptide=Lus10034380 locus=Lus10034380.g ID=Lus10034380.BGIv1.0 annot-version=v1.0 ATGGAAATCCAGACCACTCTCAAACACCCTCTACGGCTAGTTCGGCGACGAGGAGAAGATCTTCCTCATACTCGATATATTGCGAGTCTTGCGTATACAT CAGCTTATTGCCATGGAAAGGATGTAATCCACAGAGACATTAAGCCGGAGAATCTATTGCTTGATCATTATGAGATTCATAAGTTGCGACGGTTATCACA TCGGAAAATCCGTTCAGATGAGAAATCTCGGCACTCTGATGAATGGAAGAAGAAGGATGCGTTGAGATCTATGAATTCAGAAGCTCCGACGTCGAAATCT CCTTATTTTGAAGCTCCTATGTTGAGATATCTCAATGTAGAGGTTGTGGATCTTAATCCAACTGTTGGAGTTGCAATGATGTCGTTGAGATTCATCCTGT GTCCGATTACAAAGATAGTGAGAGAGACAGTTGATCTTTTTGAAGATAAAGATGAAGATGAAGATGGAAAGATATGGCTAGTGGGAAAAGTTTAA
AA sequence Show only first row Show all	>Lus10034380 pacid=23175933 polypeptide=Lus10034380 locus=Lus10034380.g ID=Lus10034380.BGIv1.0 annot-version=v1.0 MEIQTTLKHPLRLVRRRGEDLPHTRYIASLAYTSAYCHGKDVIHRDIKPENLLLDHYEIHKLRRLSHRKIRSDEKSRHSDEWKKKDALRSMNSEAPTSKS PYFEAPMLRYLNVEVVDLNPTVGVAMMSLRFILCPITKIVRETVDLFEDKDEDEDGKIWLVGKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10034380 [exp]	0	1
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10028440 [exp]	1.0	0.8965
					Lus10040805 [exp]	1.7	0.8096
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10018411 [exp]	2.2	0.7918
AT1G13030			sphere organelles protein-rela...		Lus10006465 [exp]	3.2	0.8406
					Lus10000169 [exp]	6.3	0.7973
					Lus10040989 [exp]	6.6	0.7541
AT4G18425			Protein of unknown function (D...		Lus10013974 [exp]	7.5	0.7448
					Lus10038619 [exp]	8.8	0.7898
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10020124 [exp]	10.4	0.7427
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031236 [exp]	12.7	0.7698

Compare expression of checked genes

Lus10034380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.