Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68765 44 / 5e-07 IDA INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) AT3G25655 40 / 2e-05 IDL1 inflorescence deficient in abscission (IDA)-like 1 (.1) AT5G64667 40 / 2e-05 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034260 [exp] 159 / 1e-52 AT1G68765 44 / 6e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10005811 [exp] 36 / 0.0006 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G114600 [exp] 94 / 1e-26 AT1G68765 46 / 5e-08 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.010G131500 [exp] 84 / 1e-22 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.005G189900 [exp] 40 / 9e-06 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.007G110700 [exp] 39 / 3e-05 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G057400 [exp] 39 / 5e-05 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 39 / 5e-05 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.013G074000 [exp] 39 / 6e-05 AT1G68765 43 / 7e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034385 pacid=23175998 polypeptide=Lus10034385 locus=Lus10034385.g ID=Lus10034385.BGIv1.0 annot-version=v1.0 ATGGCGGCATCGAGCTCTTCATCATCAACGTCTTCTGTTTTCCTGGTCGGGGTGATTATTGCTCTGTTCCTGCTCATTGCTTCATGCTCTGCCACCAGAC CAGGAGCTATGTTATTAGTGGAGGACCGTCCAATGGCTCCCGGAAACGATGTGGTCGGAAGCGCACGGAAACTGTACCTGAAAGCGTTCCAGTTGGACGG TCAACAATTCAACTTCTTGCCCAAAGGGGTTCCGATTCCGCCCTCCGGTCCCTCCAAACAACACAACTCTGTGGAGAACTGA
AA sequence Show only first row Show all	>Lus10034385 pacid=23175998 polypeptide=Lus10034385 locus=Lus10034385.g ID=Lus10034385.BGIv1.0 annot-version=v1.0 MAASSSSSSTSSVFLVGVIIALFLLIASCSATRPGAMLLVEDRPMAPGNDVVGSARKLYLKAFQLDGQQFNFLPKGVPIPPSGPSKQHNSVEN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68765		IDA	INFLORESCENCE DEFICIENT IN ABS...		Lus10034385 [exp]	0	1
					Lus10020455 [exp]	1.0	0.9884
AT5G06740			Concanavalin A-like lectin pro...		Lus10021060 [exp]	4.1	0.9512
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10035479 [exp]	4.6	0.9664
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10027586 [exp]	4.7	0.9748
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10031235 [exp]	5.3	0.9626
AT3G50930		BCS1	cytochrome BC1 synthesis (.1)		Lus10025989 [exp]	6.9	0.9637
AT2G33420			Protein of unknown function (D...		Lus10011785 [exp]	8.0	0.9518
AT5G39160			RmlC-like cupins superfamily p...		Lus10035185 [exp]	8.4	0.9531
AT1G11050			Protein kinase superfamily pro...		Lus10028553 [exp]	11.5	0.9423
AT1G20870			HSP20-like chaperones superfam...		Lus10007642 [exp]	12.1	0.9504

Compare expression of checked genes

Lus10034385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.