Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14790 142 / 1e-40 ATRDRP1, RDR1 RNA-dependent RNA polymerase 1 (.1) AT4G11130 91 / 1e-22 SMD1, RDR2 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1) AT3G49500 56 / 2e-10 SDE1, SGS2, RDR6 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019164 [exp] 169 / 6e-50 AT1G14790 1447 / 0.0 RNA-dependent RNA polymerase 1 (.1) Lus10034262 [exp] 160 / 1e-49 AT1G14790 381 / 2e-123 RNA-dependent RNA polymerase 1 (.1) Lus10042134 [exp] 94 / 9e-24 AT4G11130 1368 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1) Lus10002361 [exp] 93 / 2e-23 AT4G11130 659 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1) Lus10002910 [exp] 76 / 3e-17 AT3G49500 1203 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1) Lus10002017 [exp] 76 / 4e-17 AT3G49500 1605 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G136100 [exp] 142 / 8e-41 AT1G14790 1448 / 0.0 RNA-dependent RNA polymerase 1 (.1) Potri.008G135800 [exp] 127 / 2e-35 AT1G14790 1205 / 0.0 RNA-dependent RNA polymerase 1 (.1) Potri.010G105200 [exp] 123 / 5e-34 AT1G14790 1298 / 0.0 RNA-dependent RNA polymerase 1 (.1) Potri.010G104900 [exp] 122 / 2e-33 AT1G14790 1276 / 0.0 RNA-dependent RNA polymerase 1 (.1) Potri.015G073700 [exp] 95 / 7e-24 AT4G11130 1422 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1) Potri.018G028100 [exp] 71 / 1e-15 AT3G49500 1753 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1) Potri.006G253500 [exp] 71 / 1e-15 AT3G49500 1739 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05183 [flax] [poplar] RdRP RNA dependent RNA polymerase
Representative CDS sequence Show only first row Show all	>Lus10034390 pacid=23175852 polypeptide=Lus10034390 locus=Lus10034390.g ID=Lus10034390.BGIv1.0 annot-version=v1.0 ATGGAAGCTTTGGATTATACACCTCCACCAATTGTCCAGCTAGATCATGATGTTACCATTGAGGAAGTGGAAGAATGCTTCACCAGCTACATAGTGAATG AAAGTCCAGGAATAATTGTAAATGCTCACATCGCTTTTGCTGACAAGGAGCCGCTAAAAGCCATGAGCAAACGATGCTTAGGGCTTGCAGAGAAGTTCTC GATAGCAGTCGATTTCCCGAAAACGGGAGTTCCAGCTGAGATACCTCCTCATCTCTACGTCAAAGAATACCCGGACTTCATGAAAAGCCCGACAAGCCAA CATTTCAATCCAACAATGTGA
AA sequence Show only first row Show all	>Lus10034390 pacid=23175852 polypeptide=Lus10034390 locus=Lus10034390.g ID=Lus10034390.BGIv1.0 annot-version=v1.0 MEALDYTPPPIVQLDHDVTIEEVEECFTSYIVNESPGIIVNAHIAFADKEPLKAMSKRCLGLAEKFSIAVDFPKTGVPAEIPPHLYVKEYPDFMKSPTSQ HFNPTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Lus10034390 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Lus10037731 [exp]	1.0	0.9826
AT1G61550			S-locus lectin protein kinase ...		Lus10037730 [exp]	2.0	0.9242
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10004214 [exp]	2.0	0.9011
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Lus10034391 [exp]	2.4	0.9163
AT5G01750			Protein of unknown function (D...		Lus10009092 [exp]	3.9	0.8921
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10020877 [exp]	4.6	0.8794
AT1G08070		EMB3102, OTP82	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10030053 [exp]	9.8	0.8910
					Lus10012544 [exp]	10.8	0.8711
AT5G44510		TAO1	target of AVRB operation1 (.1)		Lus10001537 [exp]	12.1	0.8511
AT3G27540			beta-1,4-N-acetylglucosaminylt...		Lus10032088 [exp]	16.1	0.8353

Compare expression of checked genes

Lus10034390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.