Lus10034391 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14790 85 / 1e-20 ATRDRP1, RDR1 RNA-dependent RNA polymerase 1 (.1)
AT3G49500 50 / 3e-08 SDE1, SGS2, RDR6 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
AT4G11130 50 / 3e-08 SMD1, RDR2 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019164 177 / 5e-53 AT1G14790 1447 / 0.0 RNA-dependent RNA polymerase 1 (.1)
Lus10002361 59 / 2e-11 AT4G11130 659 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1)
Lus10042134 58 / 4e-11 AT4G11130 1368 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1)
Lus10002017 45 / 1e-06 AT3G49500 1605 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
Lus10002910 43 / 1e-05 AT3G49500 1203 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G136100 136 / 7e-39 AT1G14790 1448 / 0.0 RNA-dependent RNA polymerase 1 (.1)
Potri.010G105200 111 / 6e-30 AT1G14790 1298 / 0.0 RNA-dependent RNA polymerase 1 (.1)
Potri.010G104900 110 / 1e-29 AT1G14790 1276 / 0.0 RNA-dependent RNA polymerase 1 (.1)
Potri.008G135800 103 / 5e-27 AT1G14790 1205 / 0.0 RNA-dependent RNA polymerase 1 (.1)
Potri.015G073700 57 / 1e-10 AT4G11130 1422 / 0.0 SILENCING MOVEMENT DEFICIENT 1, RNA-dependent RNA polymerase 2 (.1)
Potri.006G253500 45 / 1e-06 AT3G49500 1739 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
Potri.018G028100 40 / 5e-05 AT3G49500 1753 / 0.0 SUPPRESSOR OF GENE SILENCING 2, SILENCING DEFECTIVE 1, RNA-dependent RNA polymerase 6 (.1)
PFAM info
Representative CDS sequence
>Lus10034391 pacid=23176098 polypeptide=Lus10034391 locus=Lus10034391.g ID=Lus10034391.BGIv1.0 annot-version=v1.0
ATGGCGGTAGGATCGTTGAAGAAAGAAGCAAGGTCGTGGTTCAATGAGAAGGGGAGTAATTTGGATGCAGAAGATGATGATGATGTGCATGCCAAAGCAT
CTGCTTGGTACCATGTTACGTATCATCCGGACTACTGGGGTCAGTACAACGAGGGAATGAACATGCCTCAGTTTTTGAGCTTTCCGTGGTGTGTATATGA
CAAACTGATCCAGATTAAGAAGAATAAGAGGAAGATGGCAGCTCGAATGTCATCGCTGGAACAACAGTTTCAGCTTGGATTGCGGTTAAGCTAG
AA sequence
>Lus10034391 pacid=23176098 polypeptide=Lus10034391 locus=Lus10034391.g ID=Lus10034391.BGIv1.0 annot-version=v1.0
MAVGSLKKEARSWFNEKGSNLDAEDDDDVHAKASAWYHVTYHPDYWGQYNEGMNMPQFLSFPWCVYDKLIQIKKNKRKMAARMSSLEQQFQLGLRLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14790 ATRDRP1, RDR1 RNA-dependent RNA polymerase 1... Lus10034391 0 1
AT4G27290 S-locus lectin protein kinase ... Lus10037731 1.4 0.9389
AT1G14790 ATRDRP1, RDR1 RNA-dependent RNA polymerase 1... Lus10034390 2.4 0.9163
Lus10012544 3.9 0.8916
AT1G71150 unknown protein Lus10007946 4.2 0.8641
AT4G27220 NB-ARC domain-containing disea... Lus10008516 4.6 0.8559
AT5G57910 unknown protein Lus10035808 5.7 0.8298
AT4G37380 Tetratricopeptide repeat (TPR)... Lus10026650 6.8 0.8009
AT5G44510 TAO1 target of AVRB operation1 (.1) Lus10001537 8.0 0.8508
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039429 8.5 0.8831
AT1G65810 P-loop containing nucleoside t... Lus10037353 11.0 0.8405

Lus10034391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.