Lus10034392 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49550 139 / 1e-43 BLOS2 BLOC subunit 2, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019163 170 / 4e-56 AT5G49550 103 / 7e-30 BLOC subunit 2, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G106200 149 / 2e-47 AT5G49550 155 / 9e-50 BLOC subunit 2, unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10046 BLOC1_2 Biogenesis of lysosome-related organelles complex-1 subunit 2
Representative CDS sequence
>Lus10034392 pacid=23176060 polypeptide=Lus10034392 locus=Lus10034392.g ID=Lus10034392.BGIv1.0 annot-version=v1.0
ATGGCAACTGGAAGGGAGGAACAACAAGAAGCGAATGATGAGCTTTCTGACTCCATAAACGATCTCTTCATTAGCATCACATCAATGGTGAAGGGAGAGC
TTCAGGGCACAAATAACGTATTGGCGCTTCTGGATAAGATGAACTTAAGAGTGGCTGAAGAGTATAGCAGCTTCGGCGATGTTGCTTCAGGGCTAACAGC
GTTCGTTGAGCAGTTAAAGTCGAAAAGTGGTAGCTTTGACGAGTATGTAGAACAAATCGATGCGATAGAGCAACAGGTTACCGAGTTTGAAGCTGTGATC
TCTATGCTTGATAAGTATGTTTCTTTGTTAGAATCTAAAGTACAGTCTGTGTACCAGCAACAATCATCTGCTTCATAA
AA sequence
>Lus10034392 pacid=23176060 polypeptide=Lus10034392 locus=Lus10034392.g ID=Lus10034392.BGIv1.0 annot-version=v1.0
MATGREEQQEANDELSDSINDLFISITSMVKGELQGTNNVLALLDKMNLRVAEEYSSFGDVASGLTAFVEQLKSKSGSFDEYVEQIDAIEQQVTEFEAVI
SMLDKYVSLLESKVQSVYQQQSSAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49550 BLOS2 BLOC subunit 2, unknown protei... Lus10034392 0 1
AT2G45620 Nucleotidyltransferase family ... Lus10009310 11.3 0.7811
AT5G49230 HRB1 HYPERSENSITIVE TO RED AND BLUE... Lus10017097 18.9 0.7862
AT4G25030 unknown protein Lus10033276 29.1 0.7341
AT4G18750 DOT4 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10033946 34.9 0.7176
AT3G29010 Biotin/lipoate A/B protein lig... Lus10017321 43.1 0.7285
AT3G19990 unknown protein Lus10017359 50.4 0.7308
AT4G29660 EMB2752 embryo defective 2752 (.1) Lus10032908 54.1 0.6339
AT3G47610 transcription regulators;zinc ... Lus10024226 72.2 0.6951
AT2G28370 Uncharacterised protein family... Lus10021469 72.4 0.7132
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10031022 82.3 0.7156

Lus10034392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.