Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25600 78 / 2e-20 Calcium-binding EF-hand family protein (.1) AT1G18530 74 / 5e-19 EF hand calcium-binding protein family (.1) AT1G32250 47 / 1e-08 Calcium-binding EF-hand family protein (.1) AT3G03000 46 / 5e-08 EF hand calcium-binding protein family (.1) AT3G51920 40 / 4e-06 CML9, CAM9, ATCML9 CALMODULIN LIKE PROTEIN 9, calmodulin 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017900 [exp] 96 / 4e-27 AT3G25600 252 / 4e-87 Calcium-binding EF-hand family protein (.1) Lus10027243 [exp] 68 / 2e-16 AT1G18530 208 / 5e-70 EF hand calcium-binding protein family (.1) Lus10038953 [exp] 49 / 3e-09 AT1G18530 115 / 2e-07 EF hand calcium-binding protein family (.1) Lus10004610 [exp] 48 / 1e-08 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10030986 [exp] 46 / 4e-08 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1) Lus10004539 [exp] 45 / 4e-08 AT3G03000 164 / 2e-53 EF hand calcium-binding protein family (.1) Lus10014709 [exp] 40 / 6e-06 AT4G14640 162 / 4e-52 calmodulin-like 8, calmodulin 8 (.1) Lus10014708 [exp] 40 / 8e-06 AT4G14640 163 / 2e-52 calmodulin-like 8, calmodulin 8 (.1) Lus10004088 [exp] 39 / 2e-05 AT4G14640 159 / 5e-51 calmodulin-like 8, calmodulin 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G132800 [exp] 91 / 2e-25 AT3G25600 229 / 4e-78 Calcium-binding EF-hand family protein (.1) Potri.015G052600 [exp] 72 / 3e-18 AT1G18530 213 / 8e-72 EF hand calcium-binding protein family (.1) Potri.003G095700 [exp] 49 / 3e-09 AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) Potri.001G138000 [exp] 49 / 3e-09 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.005G259900 [exp] 39 / 3e-05 AT1G76650 156 / 2e-48 calmodulin-like 38 (.1.2.3) Potri.005G215700 [exp] 38 / 4e-05 AT3G22930 200 / 8e-67 calmodulin-like 11 (.1) Potri.002G001400 [exp] 37 / 9e-05 AT5G42380 160 / 6e-50 CALMODULIN LIKE 39, calmodulin like 37 (.1) Potri.002G088500 [exp] 37 / 0.0001 AT1G24620 99 / 2e-26 EF hand calcium-binding protein family (.1) Potri.015G093800 [exp] 34 / 0.0008 AT1G76650 101 / 8e-28 calmodulin-like 38 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10034405 pacid=23175935 polypeptide=Lus10034405 locus=Lus10034405.g ID=Lus10034405.BGIv1.0 annot-version=v1.0 ATGGCCAAGATGGGCCACCCTCTTTCCTACAAGGAGCTGTCGGACATGATGAGACAGGCCGACACCAACGGCGACGGCGTCCTTAGCTTCCATGAGTTCG CCAACATCTTGGGCAGATCCGCCGCTGATTTCCTCGGCGTCGCTGTCTAG
AA sequence Show only first row Show all	>Lus10034405 pacid=23175935 polypeptide=Lus10034405 locus=Lus10034405.g ID=Lus10034405.BGIv1.0 annot-version=v1.0 MAKMGHPLSYKELSDMMRQADTNGDGVLSFHEFANILGRSAADFLGVAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25600			Calcium-binding EF-hand family...		Lus10034405 [exp]	0	1
AT2G15430		NRPE3A, NRPD3, ...	DNA-directed RNA polymerase fa...		Lus10027873 [exp]	6.8	0.8798
AT3G63095			Tetratricopeptide repeat (TPR)...		Lus10029648 [exp]	11.2	0.8004
AT5G43060			Granulin repeat cysteine prote...		Lus10014087 [exp]	11.6	0.8545
AT2G37380		MAKR3	MEMBRANE-ASSOCIATED KINASE REG...		Lus10024441 [exp]	14.8	0.8042
AT3G20890			RNA-binding (RRM/RBD/RNP motif...		Lus10009943 [exp]	21.6	0.8387
AT2G03190		ASK16	SKP1-like 16 (.1)		Lus10031747 [exp]	22.0	0.8525
AT5G67320		HOS15	high expression of osmotically...		Lus10010384 [exp]	22.9	0.8523
					Lus10024932 [exp]	27.9	0.8395
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10014308 [exp]	30.5	0.8453
AT2G37510			RNA-binding (RRM/RBD/RNP motif...		Lus10003980 [exp]	32.2	0.8323

Compare expression of checked genes

Lus10034405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.