Lus10034407 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04240 61 / 3e-12 XERICO RING/U-box superfamily protein (.1.2)
AT1G15100 56 / 1e-10 RHA2A RING-H2 finger A2A (.1)
AT2G01150 52 / 2e-09 RHA2B RING-H2 finger protein 2B (.1)
AT4G00305 52 / 2e-09 RING/U-box superfamily protein (.1)
AT5G17600 52 / 2e-08 RING/U-box superfamily protein (.1)
AT1G80400 52 / 2e-08 RING/U-box superfamily protein (.1)
AT3G61460 50 / 2e-08 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT3G62690 51 / 3e-08 ATL5 AtL5 (.1)
AT3G51325 49 / 3e-08 RING/U-box superfamily protein (.1)
AT5G45290 51 / 4e-08 RING/U-box superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019150 198 / 2e-66 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2)
Lus10007936 64 / 2e-13 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
Lus10013475 63 / 3e-13 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10008283 57 / 8e-11 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10007937 57 / 1e-10 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1)
Lus10003617 53 / 2e-09 AT2G01150 63 / 6e-13 RING-H2 finger protein 2B (.1)
Lus10019685 53 / 3e-09 AT5G43200 62 / 4e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Lus10008235 52 / 1e-08 AT5G20885 61 / 5e-12 RING/U-box superfamily protein (.1)
Lus10016428 51 / 1e-08 AT5G45290 59 / 2e-11 RING/U-box superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G133300 67 / 5e-15 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133200 66 / 2e-14 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G047100 61 / 1e-12 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.010G133700 61 / 2e-12 AT3G61460 66 / 4e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.008G185800 60 / 4e-12 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.005G081300 58 / 3e-11 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.007G086200 56 / 1e-10 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.007G086300 56 / 2e-10 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.014G170400 54 / 7e-10 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.007G086100 54 / 1e-09 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10034407 pacid=23175840 polypeptide=Lus10034407 locus=Lus10034407.g ID=Lus10034407.BGIv1.0 annot-version=v1.0
ATGTCGAAATTCTTCAATCTCATCTCCAACCAACTCCAATGGGTTCTGGAATTCTTGAATTCCATTCGCAGACAGCTCGGAAGAAATTGTGAAATGGGAA
AACAGAGTTCAGCTGGCCTCTGCCACTACTGCTACTACAGCGGCAGCAACACCTCAGAATTCGAAGACTGCTCAATCTGTCAGGCCAGGATTCAGCAAAG
CGAACAAGTTACCGAATTGAGATGCAACCATTTGTTCCACAGAGCTTGCTTGGACCGATGGTTCAGATCATCCGACTTGACTTGCCCGCTTTGCAGGGAC
AACTTAGCTCTCACCGCCGCCGACGACCGAGGAGTTCATGTTTTCCAGCTGCAGTTCGTGAGTACTACTAGTTTTCGATCCTCGGACGACCGGGATTCCT
TTTGGTTACGATGA
AA sequence
>Lus10034407 pacid=23175840 polypeptide=Lus10034407 locus=Lus10034407.g ID=Lus10034407.BGIv1.0 annot-version=v1.0
MSKFFNLISNQLQWVLEFLNSIRRQLGRNCEMGKQSSAGLCHYCYYSGSNTSEFEDCSICQARIQQSEQVTELRCNHLFHRACLDRWFRSSDLTCPLCRD
NLALTAADDRGVHVFQLQFVSTTSFRSSDDRDSFWLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04240 XERICO RING/U-box superfamily protein... Lus10034407 0 1
AT5G59590 UGT76E2 UDP-glucosyl transferase 76E2 ... Lus10016460 7.1 0.9137
AT2G10950 BSD domain-containing protein ... Lus10039982 7.5 0.9254
AT5G55530 Calcium-dependent lipid-bindin... Lus10003765 11.2 0.9020
AT3G10915 Reticulon family protein (.1.2... Lus10034224 11.5 0.9191
AT1G50480 THFS 10-formyltetrahydrofolate synt... Lus10039200 13.0 0.8963
AT1G07570 APK1A Protein kinase superfamily pro... Lus10002697 14.1 0.9151
AT1G01490 Heavy metal transport/detoxifi... Lus10017520 14.4 0.9142
AT5G18480 PGSIP6 plant glycogenin-like starch i... Lus10000818 18.8 0.9085
AT1G14820 Sec14p-like phosphatidylinosit... Lus10034577 19.1 0.9130
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Lus10018142 21.9 0.9021

Lus10034407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.