Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02050 162 / 3e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019137 [exp] 212 / 3e-73 AT2G02050 163 / 5e-54 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Lus10031932 [exp] 208 / 7e-71 AT2G02050 164 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Lus10035094 [exp] 206 / 8e-71 AT2G02050 161 / 4e-53 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G099900 [exp] 176 / 5e-59 AT2G02050 159 / 2e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1) Potri.008G141900 [exp] 173 / 7e-58 AT2G02050 159 / 3e-52 NADH-ubiquinone oxidoreductase B18 subunit, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF05676 [flax] [poplar] NDUF_B7 NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7)
Representative CDS sequence Show only first row Show all	>Lus10034424 pacid=23175890 polypeptide=Lus10034424 locus=Lus10034424.g ID=Lus10034424.BGIv1.0 annot-version=v1.0 ATGGAAGTCCCAGGATCATCGAAGCCTATGATTGCCACCCAGGCGGAGATGGTGGAAGAGAGGGTCCCCATGGCTTACAGAGACCAGTGCGCCCACCTCC TCATCCCGCTCAACAAGTGTCGCCAGTCCGAGTTCTACCTGCCCTGGAAGTGCGAGGACGAGCGCCATTCCTATGAGAAGTGCGAGTACGAGCTTGTCAT GGAGAGGATGCTCCAGATGCAGAAGATCCGCGAAGAGGAGGCCAAGCTCAAACACCCGAACAAACAAGGAGGTGCTGCTATCGGTCTCATCCCCAAGACT GCCAATGCCTAG
AA sequence Show only first row Show all	>Lus10034424 pacid=23175890 polypeptide=Lus10034424 locus=Lus10034424.g ID=Lus10034424.BGIv1.0 annot-version=v1.0 MEVPGSSKPMIATQAEMVEERVPMAYRDQCAHLLIPLNKCRQSEFYLPWKCEDERHSYEKCEYELVMERMLQMQKIREEEAKLKHPNKQGGAAIGLIPKT ANA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10034424 [exp]	0	1
AT5G13450		ATP5	delta subunit of Mt ATP syntha...		Lus10016414 [exp]	3.2	0.8322
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10008448 [exp]	5.0	0.8485
AT1G64980			Nucleotide-diphospho-sugar tra...		Lus10005005 [exp]	6.7	0.8106
AT1G28580			GDSL-like Lipase/Acylhydrolase...		Lus10019947 [exp]	8.9	0.7571
AT4G29350		PRF2, PFN2, PRO...	profilin 2 (.1)		Lus10012936 [exp]	10.4	0.7805
					Lus10010492 [exp]	11.4	0.8031
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10034442 [exp]	11.5	0.7745
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10023337 [exp]	12.0	0.7776
AT5G40150			Peroxidase superfamily protein...		Lus10014517 [exp]	14.3	0.8038
AT5G40140			RING/U-box superfamily protein...		Lus10039470 [exp]	16.7	0.7713

Compare expression of checked genes

Lus10034424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.