Plant FIBer expression Database

Lus10034442 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10860 116 / 4e-36 Cytochrome b-c1 complex, subunit 8 protein (.1)
AT5G05370 112 / 2e-34 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019118
[exp]
119 / 3e-37 AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1)
Lus10035013
[exp]
81 / 2e-22 AT5G05370 75 / 6e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
Lus10021674
[exp]
80 / 7e-22 AT5G05370 75 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G132000
[exp]
127 / 1e-40 AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
Potri.013G159700
[exp]
127 / 1e-40 AT3G10860 120 / 8e-38 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0429 UcrQ-like PF10890 Cyt_b-c1_8 Cytochrome b-c1 complex subunit 8
Representative CDS sequence
>Lus10034442 pacid=23175857 polypeptide=Lus10034442 locus=Lus10034442.g ID=Lus10034442.BGIv1.0 annot-version=v1.0
ATGGGGAAGCAACCAGTGAGGATGAGAGCTGTGATTTACGCGCTCTCCCCTTTCCAACAGAAGACTGTTTCAGGCCTCTTTAGGGATCTGCCTTCCAAGC
TCCAGCACAAGGTTTCTGAGAATTGGCTCAGCGCCACCCTCCTCCTCACACCTGTCGTCGGTGTCTACACGTATGTCCAGAACTACCAGGAGAAAGAGAA
GATGGAACACAGATACTGA
AA sequence
>Lus10034442 pacid=23175857 polypeptide=Lus10034442 locus=Lus10034442.g ID=Lus10034442.BGIv1.0 annot-version=v1.0
MGKQPVRMRAVIYALSPFQQKTVSGLFRDLPSKLQHKVSENWLSATLLLTPVVGVYTYVQNYQEKEKMEHRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10860 Cytochrome b-c1 complex, subun... Lus10034442
[exp]
0 1
AT1G50740 Transmembrane proteins 14C (.1... Lus10019624
[exp]
2.0 0.8334
AT1G79690 ATNUDT3 nudix hydrolase homolog 3 (.1) Lus10026103
[exp]
2.0 0.7975
AT4G32530 ATPase, F0/V0 complex, subunit... Lus10000347
[exp]
2.8 0.8081
AT1G53840 ATPME1 pectin methylesterase 1 (.1) Lus10026435
[exp]
4.2 0.7761
AT1G48440 B-cell receptor-associated 31-... Lus10040126
[exp]
7.7 0.7944
AT1G48440 B-cell receptor-associated 31-... Lus10001080
[exp]
9.5 0.8034
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10034424
[exp]
11.5 0.7745
AT3G62790 NADH-ubiquinone oxidoreductase... Lus10035034
[exp]
12.2 0.7906
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10001986
[exp]
13.4 0.7498
AT4G34700 CIB22, AtCIB22 B22 subunit of eukaryotic mito... Lus10031084
[exp]
13.4 0.7671

Lus10034442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.