Lus10034447 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49350 41 / 9e-05 Glycine-rich protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019112 230 / 5e-79 ND 40 / 2e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G158300 104 / 4e-29 AT5G49350 44 / 1e-05 Glycine-rich protein family (.1.2)
Potri.005G019200 41 / 5e-05 AT1G56320 130 / 4e-39 unknown protein
PFAM info
Representative CDS sequence
>Lus10034447 pacid=23175892 polypeptide=Lus10034447 locus=Lus10034447.g ID=Lus10034447.BGIv1.0 annot-version=v1.0
ATGGCATTAATCAACAGCAGCAGCTTCCTCTGCATCTCCGCTGGTGTTTTCTTGCTCCTACTTCTCCATTCAAATGCCAGTGCTGAAAACCCGTTGAAGA
ACGTGAACCTAAGCCCCTTCCGGCAGTGGAGAAGCGCATACGACTGCATGCAAAATTTTACAGCTAGCTGCACGGGGAAGGACGTGCTGACGCTGGCAGG
AGTGGTGGACGTGAACCAGACAGAGGTAGCAGATTACTGCAAGGAAGGAGGTTGCTGGAGGCACACCATGGATGTCCTCTACTGCATCTCTATGGTGAAG
AGGGACTTCTGGTTCGCTAACAAGGCCACCGTCCACGCCTTGTCCGTTGCTATCACCAATGGCTGCCAATCCAACACTGCTTTCACTACTGCAAACTACA
CCCCTACTGCCACTGCTTGA
AA sequence
>Lus10034447 pacid=23175892 polypeptide=Lus10034447 locus=Lus10034447.g ID=Lus10034447.BGIv1.0 annot-version=v1.0
MALINSSSFLCISAGVFLLLLLHSNASAENPLKNVNLSPFRQWRSAYDCMQNFTASCTGKDVLTLAGVVDVNQTEVADYCKEGGCWRHTMDVLYCISMVK
RDFWFANKATVHALSVAITNGCQSNTAFTTANYTPTATA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49350 Glycine-rich protein family (.... Lus10034447 0 1
AT4G17905 ATL4H RING/U-box superfamily protein... Lus10025338 2.8 0.7532
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Lus10040322 8.9 0.6880
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Lus10042395 9.6 0.7005
Lus10032314 15.9 0.6860
Lus10027667 20.1 0.6738
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10040652 20.2 0.6882
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10010474 20.5 0.6488
AT1G17930 Aminotransferase-like, plant m... Lus10001981 21.2 0.6738
Lus10015682 22.2 0.6738
AT3G20800 Cell differentiation, Rcd1-lik... Lus10015136 22.4 0.6777

Lus10034447 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.