Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019094 [exp] 89 / 9e-24 AT3G47510 50 / 1e-08 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034460 pacid=23176067 polypeptide=Lus10034460 locus=Lus10034460.g ID=Lus10034460.BGIv1.0 annot-version=v1.0 ATGGCGGCAGCTCTTCCAAGACCATTTGGGTCGGTCTTCTTTTTAGTAGTGGTCATGGGGGTTGTTTACGTTGTAATCCTCTCCCCAGATATAACTAATG CTGCCCCTGTTACAAGAATCGGCAGATTAATTCTGCAGCAGGATCAACAAGCTGTTGTAATTCCGGAGATCACTAGCCACCAGGAGGTGAAAGAAGAAAC GATTAGTATGGATGGGGAAGAAGGGAAGAAGCGATTAGGATGGATGGGGAAGAAGGTGCGGTGA
AA sequence Show only first row Show all	>Lus10034460 pacid=23176067 polypeptide=Lus10034460 locus=Lus10034460.g ID=Lus10034460.BGIv1.0 annot-version=v1.0 MAAALPRPFGSVFFLVVVMGVVYVVILSPDITNAAPVTRIGRLILQQDQQAVVIPEITSHQEVKEETISMDGEEGKKRLGWMGKKVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034460 [exp]	0	1
AT1G03055			unknown protein		Lus10018752 [exp]	5.2	0.8553
					Lus10022087 [exp]	7.4	0.8908
AT2G37710		RLK	receptor lectin kinase (.1)		Lus10033776 [exp]	11.4	0.8858
AT3G60600		(AT)VAP, (AT)VA...	VAMP/SYNAPTOBREVIN-ASSOCIATED ...		Lus10007463 [exp]	13.9	0.8680
AT1G30110		ATNUDX25	nudix hydrolase homolog 25 (.1...		Lus10003714 [exp]	15.6	0.8738
AT1G44170		ALDH4, ALDH3H1	aldehyde dehydrogenase 4, alde...		Lus10025681 [exp]	20.0	0.8812
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030597 [exp]	24.7	0.8499
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030599 [exp]	29.7	0.8495
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Lus10019247 [exp]	30.2	0.8234
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10027940 [exp]	32.6	0.8601

Compare expression of checked genes

Lus10034460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.