Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21100 89 / 9e-24 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 72 / 4e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 72 / 4e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT1G22900 71 / 5e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 69 / 2e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G58090 70 / 5e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 67 / 8e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 68 / 9e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 67 / 1e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 66 / 4e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034476 [exp] 155 / 5e-50 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 144 / 2e-45 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 115 / 3e-34 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 114 / 4e-34 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025065 [exp] 112 / 1e-32 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10005062 [exp] 112 / 1e-32 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034478 [exp] 111 / 5e-32 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10027834 [exp] 110 / 1e-31 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034480 [exp] 101 / 2e-29 AT2G21100 112 / 1e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G131000 [exp] 88 / 1e-23 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G214600 [exp] 82 / 2e-21 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 81 / 1e-20 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 77 / 4e-19 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216400 [exp] 77 / 5e-19 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023600 [exp] 76 / 5e-19 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 76 / 1e-18 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 74 / 8e-18 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 73 / 1e-17 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G061400 [exp] 73 / 1e-17 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10034473 pacid=23175914 polypeptide=Lus10034473 locus=Lus10034473.g ID=Lus10034473.BGIv1.0 annot-version=v1.0 ATGGCGCTGGGCTTCAGCTTTCTTGATGGGCCTTATAATGGGAGTACGATAAGCGTGGTCGGGAAAAATCCGGCGATGAATCCGGACAGGGAGCTGCCGG TTGTCGGCGGCACGGGGGTTTTCAGGATGGCACGTGGGTACGCGCTGCTGAAAACGGTGTCGGTTACTCAGGGCGGGGCTGCAGTGGTTCATTACGACGT TACCGTGCACACGCCCCCAGCTGATTGTCACTGA
AA sequence Show only first row Show all	>Lus10034473 pacid=23175914 polypeptide=Lus10034473 locus=Lus10034473.g ID=Lus10034473.BGIv1.0 annot-version=v1.0 MALGFSFLDGPYNGSTISVVGKNPAMNPDRELPVVGGTGVFRMARGYALLKTVSVTQGGAAVVHYDVTVHTPPADCH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21100			Disease resistance-responsive ...		Lus10034473 [exp]	0	1
AT4G33985			Protein of unknown function (D...		Lus10027898 [exp]	1.0	0.9710
					Lus10017290 [exp]	2.0	0.9326
AT4G21480		STP12	sugar transporter protein 12 (...		Lus10012766 [exp]	5.7	0.8762
AT2G15220			Plant basic secretory protein ...		Lus10001358 [exp]	8.5	0.8937
					Lus10006918 [exp]	10.1	0.9236
					Lus10007508 [exp]	11.7	0.9236
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009516 [exp]	13.0	0.9236
					Lus10027066 [exp]	14.3	0.9236
AT1G04670			unknown protein		Lus10004041 [exp]	15.4	0.9236
					Lus10040397 [exp]	16.5	0.9236

Compare expression of checked genes

Lus10034473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.