Lus10034474 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20940 135 / 1e-41 Protein of unknown function (DUF1279) (.1)
AT2G27290 42 / 3e-05 Protein of unknown function (DUF1279) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025069 270 / 7e-94 AT2G20940 134 / 4e-40 Protein of unknown function (DUF1279) (.1)
Lus10013320 38 / 0.0007 AT2G27290 186 / 2e-60 Protein of unknown function (DUF1279) (.1)
Lus10005208 38 / 0.0008 AT2G27290 185 / 7e-60 Protein of unknown function (DUF1279) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G136100 169 / 7e-55 AT2G20940 155 / 2e-49 Protein of unknown function (DUF1279) (.1)
Potri.009G161800 40 / 0.0001 AT2G27290 153 / 6e-47 Protein of unknown function (DUF1279) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06916 DUF1279 Protein of unknown function (DUF1279)
Representative CDS sequence
>Lus10034474 pacid=23176129 polypeptide=Lus10034474 locus=Lus10034474.g ID=Lus10034474.BGIv1.0 annot-version=v1.0
ATGGTGGGCGGTCGATTCAGGGAGCTACTGAAGAAATACGGCAAGGTGGCGTTGGGGGTTCACTTCTCCGTCTCAGCCGCTTCGATCTCCGGCCTTTATG
TCGCCATAAGGAACAATGTCGACGTGGAATCGGTCTTCGACAAGCTGCACCTCCCCGGCCTGTCTTCCAACAAAGATGGAGAGTCCTCCACCGTCGCCGA
TCCGAACCAGCAAGCTCCTCCGGTGGAAGGAGCTTCGATTGAAGAGAAGACGAAGAGCGGCAGGAATCGGGTGGCGGAGCTAGCTGCTTCGAGCGGCGGC
GCGTTTGCTGTGGCTCTGCTGTTCAACAAGGCTCTGTTCCCGATTAGGGTGCCGATCACGATCGCGCTCACTCCTGCGGTGGCGAAGGCTTTGGCCAGGA
GAGGACTGATTCGAAGTGTATGA
AA sequence
>Lus10034474 pacid=23176129 polypeptide=Lus10034474 locus=Lus10034474.g ID=Lus10034474.BGIv1.0 annot-version=v1.0
MVGGRFRELLKKYGKVALGVHFSVSAASISGLYVAIRNNVDVESVFDKLHLPGLSSNKDGESSTVADPNQQAPPVEGASIEEKTKSGRNRVAELAASSGG
AFAVALLFNKALFPIRVPITIALTPAVAKALARRGLIRSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20940 Protein of unknown function (D... Lus10034474 0 1
AT4G18372 Small nuclear ribonucleoprotei... Lus10000241 1.0 0.8220
AT5G62030 diphthamide synthesis DPH2 fam... Lus10039108 6.0 0.7749
AT5G41685 Mitochondrial outer membrane t... Lus10001641 7.9 0.7575
AT3G59520 ATRBL13 RHOMBOID-like protein 13 (.1) Lus10008156 8.8 0.7710
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10023928 10.8 0.7882
AT3G20890 RNA-binding (RRM/RBD/RNP motif... Lus10030139 11.4 0.7713
AT3G21740 APO4 ACCUMULATION OF PHOTOSYSTEM ON... Lus10039659 12.0 0.7956
AT4G04950 AtGRXS17 Arabidopsis thaliana monothiol... Lus10011187 18.3 0.7593
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10017293 19.0 0.7096
AT1G05600 EMB3101 EMBRYO DEFECTIVE 3101, Tetratr... Lus10030200 27.1 0.7198

Lus10034474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.