Lus10034476 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 219 / 5e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 160 / 7e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 157 / 6e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 155 / 7e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 154 / 8e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 140 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 135 / 3e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 134 / 1e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G21110 125 / 2e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 125 / 4e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025067 329 / 1e-116 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 233 / 1e-78 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 230 / 1e-77 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 228 / 6e-76 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 224 / 2e-74 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 212 / 3e-69 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 211 / 3e-69 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 209 / 3e-68 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 209 / 4e-68 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 217 / 2e-72 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 178 / 6e-57 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 172 / 6e-55 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 169 / 1e-53 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 163 / 5e-51 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 162 / 8e-51 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 161 / 3e-50 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G060900 160 / 1e-49 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 158 / 5e-49 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023600 155 / 6e-48 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10034476 pacid=23176031 polypeptide=Lus10034476 locus=Lus10034476.g ID=Lus10034476.BGIv1.0 annot-version=v1.0
ATGTCGTCGTCGCTCTTCGTCGTAACGTTCCTCCTCCTCTCCGCGGCGGTTTCTGGCCACAACAAAATATCTCCATCAGCGTCGTCGTCGGTCAAGTGGG
CGAAGAGGCTCGAGTCTTGCGAACCGGGCAAGGAGACGGTAACCAAACTCCAATTCTACTTCCATGACATCGTCACAGGGAATAACCCGACCGCAGTGAG
GGTGGCTCAGGCGCCCGGAACGGACAAGTCGCCGACGTTGTTCGGGGCCATTTTGATGGCGGACGACCCTCTTACGGAGACTGCAGACCCGACTTCCAAG
CTGATTGGGCGGGCCCAGGGGCTTTATGGGTCCGCGTCGCAGAATGATCTGGGCTTGATTATGGCGCTGGGCTTCAGCTTTCTTGATGGGCCTTATAATG
GGAGTACGATAAGCGTGGTCGGGAAAAATCCGGCGATGAATCCGGACAGGGAGCTGCCGGTTGTCGGCGGCACGGGGGTTTTCAGGATGGCACGTGGGTA
CGCGCTGCTGAAAACGTTGTCGCTTACTCAGGGCGGGGATGCGGTGGTTCATTACAACGTTACCGTGCATACGCCCCCGGCTGATTGTCACTGA
AA sequence
>Lus10034476 pacid=23176031 polypeptide=Lus10034476 locus=Lus10034476.g ID=Lus10034476.BGIv1.0 annot-version=v1.0
MSSSLFVVTFLLLSAAVSGHNKISPSASSSVKWAKRLESCEPGKETVTKLQFYFHDIVTGNNPTAVRVAQAPGTDKSPTLFGAILMADDPLTETADPTSK
LIGRAQGLYGSASQNDLGLIMALGFSFLDGPYNGSTISVVGKNPAMNPDRELPVVGGTGVFRMARGYALLKTLSLTQGGDAVVHYNVTVHTPPADCH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10034476 0 1
Lus10014650 6.4 0.5806
AT5G51490 Plant invertase/pectin methyle... Lus10027204 8.1 0.5767
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021387 12.7 0.5670
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10003585 14.3 0.5434
AT3G05950 RmlC-like cupins superfamily p... Lus10035280 16.0 0.5434
AT3G54320 AP2_ERF ATWRI1, ASML1, ... WRINKLED 1, WRINKLED, ACTIVATO... Lus10013268 17.5 0.5434
AT3G29590 AT5MAT HXXXD-type acyl-transferase fa... Lus10003345 18.9 0.5434
AT4G30590 AtENODL12 early nodulin-like protein 12 ... Lus10019955 19.9 0.5171
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Lus10005476 20.0 0.5273
AT3G50830 ATCOR413-PM2, C... cold-regulated 413-plasma memb... Lus10016782 21.9 0.5159

Lus10034476 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.