Lus10034478 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 189 / 7e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 152 / 4e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 149 / 8e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 140 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 134 / 4e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 134 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 125 / 8e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G58170 121 / 5e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 119 / 2e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 115 / 4e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025065 394 / 2e-140 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 260 / 1e-88 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 251 / 4e-85 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 245 / 5e-82 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 238 / 3e-79 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 233 / 5e-77 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 233 / 5e-77 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 231 / 7e-77 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 217 / 2e-71 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 191 / 1e-61 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 164 / 4e-51 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 155 / 2e-47 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 153 / 2e-46 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 151 / 8e-46 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 150 / 2e-45 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 150 / 3e-45 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G023600 147 / 2e-44 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 145 / 3e-43 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 143 / 2e-42 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10034478 pacid=23175876 polypeptide=Lus10034478 locus=Lus10034478.g ID=Lus10034478.BGIv1.0 annot-version=v1.0
ATGATGAGGTTATGTTGGGCTATTTTAGTAATCTCCTTGGCCGTAACCGAGCCGTCAGCAGCCCAGTCGGTCAACTGGGCCAAGAGGGTCGACTCTGGAA
ACGGTCCAGATGCGGTCACAAACATCCAATTCTACTTCCACGACATAGTAAGTGGGAGCAACCCAACCGCTGAGAAGGTGGTCGAACCGGTTTCCGGATC
ATCCACGGTTTTCGGCCAAATCAACATAGCCGACGACCCACTGACCGAGACCTCCGACCCGAAATCCAAGCTCGTAGGCAGGGCCCAGGGGCTCTACGGT
TTTGCAAGCGAGACAGACATGGCTCTGCTAATGGTTATGAGCTACGGGTTCACCGACGGGCCCTATAAAGGTAGCTCGCTCAGCATCATGGGCAAGAACC
AGGCCATGAACCCGACGCGGGAGCTGCCTGTTCTGGGCGGCACGGGCCTGTTCAGGATGGCTCGTGGGTACGCGCTCATGAAGACGGTGTCGTTAAGTTC
GGCAGGAGATGCTGTCGTGCATTATAATGTGACGGTGCATGCCCCGGCGGGCAATGAAGCCGCCCCGGCCTCGACTTCTTCGGTAAGTCGCGGTGGCGCT
GCCACTGGCTCGCCGAATTCTTCGTCGGCGTCGTCTTCTGCTTCAACTCCGGTGATTTTGCGTGGAAAACAATGGGTCGTTAGTGCTTTGATGGCTTGTA
CCGCTTTCATTTGTTTATCGTCATATGTTCTGTAA
AA sequence
>Lus10034478 pacid=23175876 polypeptide=Lus10034478 locus=Lus10034478.g ID=Lus10034478.BGIv1.0 annot-version=v1.0
MMRLCWAILVISLAVTEPSAAQSVNWAKRVDSGNGPDAVTNIQFYFHDIVSGSNPTAEKVVEPVSGSSTVFGQINIADDPLTETSDPKSKLVGRAQGLYG
FASETDMALLMVMSYGFTDGPYKGSSLSIMGKNQAMNPTRELPVLGGTGLFRMARGYALMKTVSLSSAGDAVVHYNVTVHAPAGNEAAPASTSSVSRGGA
ATGSPNSSSASSSASTPVILRGKQWVVSALMACTAFICLSSYVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10034478 0 1
AT3G56230 BTB/POZ domain-containing prot... Lus10010216 1.0 0.9592
AT3G18180 Glycosyltransferase family 61 ... Lus10036003 2.4 0.9548
AT4G06536 SPla/RYanodine receptor (SPRY)... Lus10010045 3.9 0.9487
AT3G61150 HD HD-GL2-1, HDG1 HOMEODOMAIN-GLABRA2 1, homeodo... Lus10031933 4.4 0.9239
AT3G18400 NAC ANAC058 NAC domain containing protein ... Lus10009029 5.0 0.9185
AT2G37440 DNAse I-like superfamily prote... Lus10025305 7.0 0.9034
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Lus10031859 7.5 0.9364
AT2G16750 Protein kinase protein with ad... Lus10019787 7.9 0.9394
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Lus10029585 8.0 0.9454
AT3G26590 MATE efflux family protein (.1... Lus10036854 8.1 0.9307

Lus10034478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.