Lus10034479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 189 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 156 / 8e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 145 / 2e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 138 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 135 / 2e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G58170 134 / 4e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 133 / 1e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 132 / 3e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 131 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 131 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025064 332 / 2e-118 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 252 / 7e-86 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 250 / 5e-85 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 232 / 3e-78 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 230 / 1e-77 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 228 / 3e-76 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 226 / 3e-75 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 225 / 5e-75 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 214 / 2e-71 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 196 / 2e-64 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 163 / 1e-51 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 160 / 3e-50 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 157 / 4e-49 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 157 / 5e-49 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.001G214600 156 / 8e-49 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 154 / 7e-48 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 152 / 3e-47 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 150 / 1e-46 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 150 / 2e-46 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10034479 pacid=23175992 polypeptide=Lus10034479 locus=Lus10034479.g ID=Lus10034479.BGIv1.0 annot-version=v1.0
ATGTCGACTACACTTCATGCCCAAACACCACCACTCAAATGGGCACAAAGACTGGACTCTGGAACCGGCCTTGAGACCGTAACCAACCTCCAGTTCTACT
TCCACGACATCCTGAGCGGGTCCAACCCCACCGCGAAACGAGTAGTCCAACCCATACTTGGTACCACCATCACAACCCTCTTTGGAGCGATTGTAATGGC
AGACGATCCTTTGACGGAGACATCAGACATGGGGTCCAAGCTCATCGGTCGAGCCCAAGGAATGTACAGCGCGTCCAGCCAGGAAGATATCGCTCTGTTG
ATGGTCATGAGCTACGGGTTCACGGACGGACCTTACAACGGAAGCTCGATTAGCATCATGGGTAAGAACCCGGCCATGAACCCGACAAGGGAGCTCCCCG
TTTTGGGCGGCACGGGCGTTTTTAGGATGGCACGTGGGTACGCGGCTATGAAAACGGTGTCGGTTAATGCTGGCGGGGATGCCGTTGTGTTTTATAACGT
CACGGTGTACACTCCGGCTTCGAATTAA
AA sequence
>Lus10034479 pacid=23175992 polypeptide=Lus10034479 locus=Lus10034479.g ID=Lus10034479.BGIv1.0 annot-version=v1.0
MSTTLHAQTPPLKWAQRLDSGTGLETVTNLQFYFHDILSGSNPTAKRVVQPILGTTITTLFGAIVMADDPLTETSDMGSKLIGRAQGMYSASSQEDIALL
MVMSYGFTDGPYNGSSISIMGKNPAMNPTRELPVLGGTGVFRMARGYAAMKTVSVNAGGDAVVFYNVTVYTPASN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10034479 0 1
AT2G30210 LAC3 laccase 3 (.1) Lus10042249 1.0 0.9703
AT2G21100 Disease resistance-responsive ... Lus10025065 2.0 0.9657
AT2G30210 LAC3 laccase 3 (.1) Lus10026401 3.7 0.9360
AT3G08680 Leucine-rich repeat protein ki... Lus10021383 4.2 0.9398
AT3G08680 Leucine-rich repeat protein ki... Lus10025210 4.2 0.9520
AT3G55230 Disease resistance-responsive ... Lus10003301 4.5 0.9511
AT2G34930 disease resistance family prot... Lus10006948 4.7 0.9307
AT4G23740 Leucine-rich repeat protein ki... Lus10038828 5.0 0.9099
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Lus10038392 5.1 0.9083
AT3G14470 NB-ARC domain-containing disea... Lus10042117 5.9 0.9454

Lus10034479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.