Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21100 113 / 7e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 103 / 5e-29 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 101 / 3e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 100 / 2e-27 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 94 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21110 94 / 3e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 94 / 3e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 90 / 1e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 87 / 3e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G58090 89 / 1e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034478 [exp] 162 / 3e-51 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025065 [exp] 161 / 6e-51 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 158 / 1e-50 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 157 / 2e-50 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10027834 [exp] 154 / 3e-48 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10005062 [exp] 150 / 1e-46 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 146 / 1e-45 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 147 / 2e-45 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034482 [exp] 147 / 2e-45 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216300 [exp] 123 / 1e-36 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.009G131000 [exp] 122 / 2e-36 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 121 / 6e-36 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 119 / 5e-35 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 114 / 4e-33 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G214600 [exp] 112 / 2e-32 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 109 / 3e-31 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 108 / 6e-31 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023600 [exp] 107 / 1e-30 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 105 / 1e-29 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10034480 pacid=23176046 polypeptide=Lus10034480 locus=Lus10034480.g ID=Lus10034480.BGIv1.0 annot-version=v1.0 ATGACAGACGACCCGCTGACCGAGACGCCCGAGCGGGACTCGAAACTAGTCGGGCGGGCGCAGGGGATGTACGGGTTGGCTGGAAGGAACGACATCGTCG TGCAGCTGGTAATGAGCTACGGGTTTGTAGACGGGCCCTACAATGGGAGCTCTATCAGTATTATGGGCCGGAACCTGGTTACTCACCCGACCCGAGAGGT GCCTGTTTTGGGCGGGATGGGTGTTTTCAGGATGGCGCGTGGGTATGCGGTTTTGAAGACGGTGTCGTCTAATGCTGCCGGAGATGCCGTTGTTCATTAT GATGTGACGGTTCATGCTCCGGTCGTCGCCAATGGTCACTGA
AA sequence Show only first row Show all	>Lus10034480 pacid=23176046 polypeptide=Lus10034480 locus=Lus10034480.g ID=Lus10034480.BGIv1.0 annot-version=v1.0 MTDDPLTETPERDSKLVGRAQGMYGLAGRNDIVVQLVMSYGFVDGPYNGSSISIMGRNLVTHPTREVPVLGGMGVFRMARGYAVLKTVSSNAAGDAVVHY DVTVHAPVVANGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21100			Disease resistance-responsive ...		Lus10034480 [exp]	0	1
					Lus10036838 [exp]	4.5	0.7359
					Lus10036841 [exp]	6.3	0.7359
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011999 [exp]	12.4	0.7302
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	16.0	0.6921
AT2G23945			Eukaryotic aspartyl protease f...		Lus10019960 [exp]	18.9	0.6511
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	21.3	0.6541
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	23.4	0.6541
AT3G10490	NAC	ANAC051, ANAC05...	Arabidopsis NAC domain contain...		Lus10014342 [exp]	23.8	0.4935
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	25.5	0.6491
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	28.5	0.6426

Compare expression of checked genes

Lus10034480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.