Lus10034482 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 181 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 143 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 142 / 3e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 140 / 2e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 137 / 3e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 135 / 2e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT3G13650 134 / 6e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 133 / 2e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 132 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 127 / 2e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025063 393 / 5e-140 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 234 / 1e-77 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 231 / 7e-77 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 231 / 5e-76 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 227 / 2e-75 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 221 / 2e-72 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 212 / 1e-68 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 210 / 2e-68 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 203 / 9e-66 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 190 / 5e-61 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 164 / 9e-51 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 164 / 2e-50 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 162 / 7e-50 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 157 / 1e-47 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 155 / 2e-47 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 154 / 1e-46 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G060700 153 / 3e-46 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 152 / 6e-46 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 149 / 1e-44 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10034482 pacid=23175844 polypeptide=Lus10034482 locus=Lus10034482.g ID=Lus10034482.BGIv1.0 annot-version=v1.0
ATGACGACGAAACCATCCTTAATCGTCGTCGTGGCTATCGCAATCGCCCTCTCATCATCAATTCCTTCATTCCTCGCTCAACAGCCCCCAACTCCCTCTC
CGGCCGCCGTCAGCTGGGCGACCCGCCTCCCCTCCTCCTCCGGCAGCGACACCGTCACCAACCTCCAGTTCTACTTCCACGATATCCTCAGCGGGAACAA
CCCGACAGCTGTCCAGGTCGCCTCCCCAGTCGGAGGATCCGGGTTTGGATCCATCTCGATGGCCGACGACCCGCTCACCGAGACATCCGACCCGAACTCC
AAGCTCGTCGGTCGGGCTCAGGGGATCTACGCCTCCGCCTCGCAGTCTACGCTGGCGCTGCTGATGTCGATGAGCTACAGCTTCGTGGATGGGCCCTACA
GCGGGAGCTCGCTGAGCATATTGGGCCGGAACGAGGTTATGACCCAGGGTCGGGAGCTCCCCGTTTTGGGCGGCACGGGTCTGTTCAGGATGGCACGTGG
CTACGCCGTGCTCCAAACGACGTCGGCTAATTCGGCTGGGGACGCCGTCGTGTTTTATAATGTGACGGTCTTTGCTCCTTCGTCTAATGCCCAGAATGAG
GCGCTTCCGTTTACTCCGGTTGGAGGTGGCGGTGGCGGTGGTGGAAGGAGGAGTGGAGGAGGTGGTGGTGGGAATGCAGGGGATTCTTCGCCGGCGGGGA
GGGTGCCGGCGAGTGGATGGGTTGGGGCGGTGGTTGTGGCTGCTGTGGCGTGCTTTTTGTCGATGTGA
AA sequence
>Lus10034482 pacid=23175844 polypeptide=Lus10034482 locus=Lus10034482.g ID=Lus10034482.BGIv1.0 annot-version=v1.0
MTTKPSLIVVVAIAIALSSSIPSFLAQQPPTPSPAAVSWATRLPSSSGSDTVTNLQFYFHDILSGNNPTAVQVASPVGGSGFGSISMADDPLTETSDPNS
KLVGRAQGIYASASQSTLALLMSMSYSFVDGPYSGSSLSILGRNEVMTQGRELPVLGGTGLFRMARGYAVLQTTSANSAGDAVVFYNVTVFAPSSNAQNE
ALPFTPVGGGGGGGGRRSGGGGGGNAGDSSPAGRVPASGWVGAVVVAAVACFLSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10034482 0 1
AT4G13510 ATAMT1;1, AMT1;... ARABIDOPSIS THALIANA AMMONIUM ... Lus10023705 3.6 0.8512
AT2G46620 P-loop containing nucleoside t... Lus10005991 4.9 0.8363
AT3G16510 Calcium-dependent lipid-bindin... Lus10006523 6.0 0.8254
AT4G01575 serine protease inhibitor, Kaz... Lus10030166 6.3 0.8061
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10028157 7.9 0.8389
AT2G37730 Protein of unknown function (D... Lus10024364 8.2 0.7846
AT2G39050 ArathEULS3 Euonymus lectin S3, hydroxypro... Lus10006551 9.2 0.8317
AT4G29680 Alkaline-phosphatase-like fami... Lus10008562 9.6 0.8324
AT3G25250 AtOXI1, OXI1, A... oxidative signal-inducible1, A... Lus10020411 10.2 0.7726
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10002147 12.0 0.7847

Lus10034482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.