Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66200 130 / 7e-37 ARO2 armadillo repeat only 2 (.1) AT4G34940 125 / 3e-35 ARO1 armadillo repeat only 1 (.1) AT4G36030 96 / 8e-25 ARO3 armadillo repeat only 3 (.1) AT3G26600 48 / 1e-07 ARO4 armadillo repeat only 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025059 [exp] 155 / 5e-46 AT4G34940 973 / 0.0 armadillo repeat only 1 (.1) Lus10041905 [exp] 115 / 2e-31 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1) Lus10028452 [exp] 114 / 4e-31 AT5G66200 965 / 0.0 armadillo repeat only 2 (.1) Lus10037086 [exp] 104 / 1e-28 AT5G66200 354 / 3e-118 armadillo repeat only 2 (.1) Lus10026695 [exp] 52 / 5e-09 AT3G26600 656 / 0.0 armadillo repeat only 4 (.1) Lus10004620 [exp] 51 / 6e-09 AT3G26600 661 / 0.0 armadillo repeat only 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G172500 [exp] 142 / 3e-41 AT4G34940 1020 / 0.0 armadillo repeat only 1 (.1) Potri.009G131900 [exp] 135 / 8e-39 AT4G34940 986 / 0.0 armadillo repeat only 1 (.1) Potri.005G113000 [exp] 128 / 4e-36 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1) Potri.015G082800 [exp] 66 / 3e-14 AT3G26600 610 / 0.0 armadillo repeat only 4 (.1) Potri.010G045500 [exp] 56 / 1e-10 AT3G26600 632 / 0.0 armadillo repeat only 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034485 pacid=23175913 polypeptide=Lus10034485 locus=Lus10034485.g ID=Lus10034485.BGIv1.0 annot-version=v1.0 ATGGCGGACTTCGTGAAGGAGATCCTGGCGCGGCCTATCCAATTAGCGGACCACGTCACGAAGGCCGCCGACGAGGCCCAATCCTTCAAACAAGACTGCC AGGAGATTAAATCCAAAACAGAGAAGCTCTCCTCCTTACTCCGACAAGAGGCGCGTGCGAGAAACGACCTTAACGAGCGCCCCACGCACCGCATCATTGA CGACACTGAACAGGTCCTCGACAAAGCCCTAACCATAGTGATAAAATGTTGA
AA sequence Show only first row Show all	>Lus10034485 pacid=23175913 polypeptide=Lus10034485 locus=Lus10034485.g ID=Lus10034485.BGIv1.0 annot-version=v1.0 MADFVKEILARPIQLADHVTKAADEAQSFKQDCQEIKSKTEKLSSLLRQEARARNDLNERPTHRIIDDTEQVLDKALTIVIKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66200		ARO2	armadillo repeat only 2 (.1)		Lus10034485 [exp]	0	1
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Lus10001729 [exp]	9.7	0.8761
AT2G40070			unknown protein		Lus10027767 [exp]	10.1	0.8623
AT4G13640	GARP	UNE16	unfertilized embryo sac 16, Ho...		Lus10007132 [exp]	10.6	0.8668
AT3G15820		ROD1	REDUCED OLEATE DESATURATION 1,...		Lus10035915 [exp]	15.0	0.8726
AT4G35020		ROP6, ARAC3, RH...	RHO-RELATED PROTEIN FROM PLANT...		Lus10033131 [exp]	19.4	0.8540
AT1G44130			Eukaryotic aspartyl protease f...		Lus10018148 [exp]	21.0	0.8334
AT2G24440			selenium binding (.1)		Lus10026958 [exp]	29.1	0.8723
AT3G18035		HON4	winged-helix DNA-binding trans...		Lus10004328 [exp]	38.3	0.8397
AT3G22520			unknown protein		Lus10041202 [exp]	40.6	0.8440
AT1G64080		MAKR2	MEMBRANE-ASSOCIATED KINASE REG...		Lus10017532 [exp]	42.0	0.8472

Compare expression of checked genes

Lus10034485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.